BLASTX nr result
ID: Mentha22_contig00016909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00016909 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41298.1| hypothetical protein MIMGU_mgv1a008762mg [Mimulus... 74 3e-11 >gb|EYU41298.1| hypothetical protein MIMGU_mgv1a008762mg [Mimulus guttatus] Length = 363 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/69 (53%), Positives = 47/69 (68%), Gaps = 7/69 (10%) Frame = +3 Query: 3 FPPPYHVDGWRTYAYLRMIEELHANMNN---SGAEVEMQPNQRHE----ASKLCSTSSLP 161 FPPPYHV GWRT+ YL+M+E+ AN NN S +VE+QP +R+ S L TS+LP Sbjct: 295 FPPPYHVHGWRTHTYLQMLEDSRANTNNAQTSETQVEIQPTRRNSNLSMNSSLSGTSNLP 354 Query: 162 EEDIESGRR 188 ED+ESG R Sbjct: 355 VEDLESGTR 363