BLASTX nr result
ID: Mentha22_contig00016693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00016693 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20182.1| hypothetical protein MIMGU_mgv1a011396mg [Mimulus... 70 3e-10 >gb|EYU20182.1| hypothetical protein MIMGU_mgv1a011396mg [Mimulus guttatus] gi|604300340|gb|EYU20183.1| hypothetical protein MIMGU_mgv1a011396mg [Mimulus guttatus] gi|604300341|gb|EYU20184.1| hypothetical protein MIMGU_mgv1a011396mg [Mimulus guttatus] Length = 283 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/62 (51%), Positives = 45/62 (72%) Frame = -2 Query: 187 MLPRWGRALSRMNRINGLQKSNELVKKESSFFLFRDYAKVSAAVEPTTSSDIIKPEVNLN 8 MLPRW R LSR++R+ Q++ EL++++ S F R+YA V+ AVEP +SD KP VNLN Sbjct: 1 MLPRWSRVLSRISRVGSYQRNTELLRRDLSVFPLRNYATVAPAVEPDVNSDANKPVVNLN 60 Query: 7 KL 2 K+ Sbjct: 61 KM 62