BLASTX nr result
ID: Mentha22_contig00016319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00016319 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31604.1| hypothetical protein MIMGU_mgv1a021663mg, partial... 54 9e-07 >gb|EYU31604.1| hypothetical protein MIMGU_mgv1a021663mg, partial [Mimulus guttatus] Length = 144 Score = 54.3 bits (129), Expect(2) = 9e-07 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = -1 Query: 192 AEKKILSKSWYAAWLTRPTIDFDEHDFAQKSSGAFKEFAKKTMQRYK--DLNLE 37 A+ +LSKSWY AW TRP + D DF +S +F FA K M+RY+ DLN+E Sbjct: 35 AQTTLLSKSWYRAWSTRPNLALDTRDF--RSPSSFSAFAAKAMERYEESDLNIE 86 Score = 24.3 bits (51), Expect(2) = 9e-07 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 232 LPEEVIQHIQSFMSGKE 182 LPE +IQ IQS +S K+ Sbjct: 17 LPEAIIQRIQSLLSRKQ 33