BLASTX nr result
ID: Mentha22_contig00016082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00016082 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK03539.1| predicted protein [Hordeum vulgare subsp. vulgare] 100 4e-19 ref|XP_006847021.1| hypothetical protein AMTR_s00017p00162080 [A... 99 7e-19 ref|XP_002975298.1| hypothetical protein SELMODRAFT_174818 [Sela... 99 7e-19 ref|XP_002993082.1| hypothetical protein SELMODRAFT_236668 [Sela... 99 7e-19 ref|XP_006475023.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_006352518.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_006352517.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_006344862.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_007146510.1| hypothetical protein PHAVU_006G046900g [Phas... 99 9e-19 ref|XP_006452432.1| hypothetical protein CICLE_v10010530mg [Citr... 99 9e-19 ref|XP_006406348.1| hypothetical protein EUTSA_v10021160mg [Eutr... 99 9e-19 ref|XP_007014912.1| Cell differentiation, Rcd1-like protein isof... 99 9e-19 ref|XP_007014911.1| Cell differentiation, Rcd1-like protein isof... 99 9e-19 ref|XP_007014910.1| Cell differentiation, Rcd1-like protein isof... 99 9e-19 ref|XP_007014909.1| Cell differentiation, Rcd1-like protein isof... 99 9e-19 ref|XP_004515427.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_006298010.1| hypothetical protein CARUB_v10014055mg, part... 99 9e-19 ref|XP_004297723.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_004297722.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 ref|XP_004294416.1| PREDICTED: cell differentiation protein RCD1... 99 9e-19 >dbj|BAK03539.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 331 Score = 99.8 bits (247), Expect = 4e-19 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDTDVISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 154 RPFEYLRLTSLGVIGALVKVDDTDVISFLLQTEIIPLCLRTMEMGSELSKTV 205 >ref|XP_006847021.1| hypothetical protein AMTR_s00017p00162080 [Amborella trichopoda] gi|548850050|gb|ERN08602.1| hypothetical protein AMTR_s00017p00162080 [Amborella trichopoda] Length = 311 Score = 99.0 bits (245), Expect = 7e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDTDVI+FLL TEIIPLCLRTMEMGSELSKTV Sbjct: 137 RPFEYLRLTSLGVIGALVKVDDTDVINFLLSTEIIPLCLRTMEMGSELSKTV 188 >ref|XP_002975298.1| hypothetical protein SELMODRAFT_174818 [Selaginella moellendorffii] gi|300156872|gb|EFJ23499.1| hypothetical protein SELMODRAFT_174818 [Selaginella moellendorffii] Length = 305 Score = 99.0 bits (245), Expect = 7e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDTDVI+FLL TEIIPLCLRTMEMGSELSKTV Sbjct: 124 RPFEYLRLTSLGVIGALVKVDDTDVINFLLSTEIIPLCLRTMEMGSELSKTV 175 >ref|XP_002993082.1| hypothetical protein SELMODRAFT_236668 [Selaginella moellendorffii] gi|300139082|gb|EFJ05830.1| hypothetical protein SELMODRAFT_236668 [Selaginella moellendorffii] Length = 293 Score = 99.0 bits (245), Expect = 7e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDTDVI+FLL TEIIPLCLRTMEMGSELSKTV Sbjct: 112 RPFEYLRLTSLGVIGALVKVDDTDVINFLLSTEIIPLCLRTMEMGSELSKTV 163 >ref|XP_006475023.1| PREDICTED: cell differentiation protein RCD1 homolog isoform X1 [Citrus sinensis] Length = 321 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 148 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 199 >ref|XP_006352518.1| PREDICTED: cell differentiation protein RCD1 homolog isoform X2 [Solanum tuberosum] Length = 269 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 150 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 201 >ref|XP_006352517.1| PREDICTED: cell differentiation protein RCD1 homolog isoform X1 [Solanum tuberosum] Length = 319 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 150 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 201 >ref|XP_006344862.1| PREDICTED: cell differentiation protein RCD1 homolog [Solanum tuberosum] Length = 283 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 112 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 163 >ref|XP_007146510.1| hypothetical protein PHAVU_006G046900g [Phaseolus vulgaris] gi|561019733|gb|ESW18504.1| hypothetical protein PHAVU_006G046900g [Phaseolus vulgaris] Length = 323 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 150 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 201 >ref|XP_006452432.1| hypothetical protein CICLE_v10010530mg [Citrus clementina] gi|568842169|ref|XP_006475024.1| PREDICTED: cell differentiation protein RCD1 homolog isoform X2 [Citrus sinensis] gi|557555658|gb|ESR65672.1| hypothetical protein CICLE_v10010530mg [Citrus clementina] Length = 321 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 148 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 199 >ref|XP_006406348.1| hypothetical protein EUTSA_v10021160mg [Eutrema salsugineum] gi|557107494|gb|ESQ47801.1| hypothetical protein EUTSA_v10021160mg [Eutrema salsugineum] Length = 316 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 146 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 197 >ref|XP_007014912.1| Cell differentiation, Rcd1-like protein isoform 4 [Theobroma cacao] gi|508785275|gb|EOY32531.1| Cell differentiation, Rcd1-like protein isoform 4 [Theobroma cacao] Length = 322 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 149 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 200 >ref|XP_007014911.1| Cell differentiation, Rcd1-like protein isoform 3 [Theobroma cacao] gi|508785274|gb|EOY32530.1| Cell differentiation, Rcd1-like protein isoform 3 [Theobroma cacao] Length = 321 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 148 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 199 >ref|XP_007014910.1| Cell differentiation, Rcd1-like protein isoform 2 [Theobroma cacao] gi|508785273|gb|EOY32529.1| Cell differentiation, Rcd1-like protein isoform 2 [Theobroma cacao] Length = 321 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 148 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 199 >ref|XP_007014909.1| Cell differentiation, Rcd1-like protein isoform 1 [Theobroma cacao] gi|508785272|gb|EOY32528.1| Cell differentiation, Rcd1-like protein isoform 1 [Theobroma cacao] Length = 321 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 148 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 199 >ref|XP_004515427.1| PREDICTED: cell differentiation protein RCD1 homolog [Cicer arietinum] Length = 324 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 151 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 202 >ref|XP_006298010.1| hypothetical protein CARUB_v10014055mg, partial [Capsella rubella] gi|482566719|gb|EOA30908.1| hypothetical protein CARUB_v10014055mg, partial [Capsella rubella] Length = 356 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 186 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 237 >ref|XP_004297723.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 2 [Fragaria vesca subsp. vesca] Length = 319 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 146 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 197 >ref|XP_004297722.1| PREDICTED: cell differentiation protein RCD1 homolog isoform 1 [Fragaria vesca subsp. vesca] Length = 319 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 146 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 197 >ref|XP_004294416.1| PREDICTED: cell differentiation protein RCD1 homolog [Fragaria vesca subsp. vesca] Length = 311 Score = 98.6 bits (244), Expect = 9e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 543 RPFEYLRLTSLGVIGALVKVDDTDVISFLLFTEIIPLCLRTMEMGSELSKTV 388 RPFEYLRLTSLGVIGALVKVDDT+VISFLL TEIIPLCLRTMEMGSELSKTV Sbjct: 137 RPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTV 188