BLASTX nr result
ID: Mentha22_contig00015967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00015967 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007132663.1| hypothetical protein PHAVU_011G114300g [Phas... 59 1e-06 ref|XP_003540907.2| PREDICTED: GPI-anchored protein LORELEI-like... 58 1e-06 ref|XP_004294295.1| PREDICTED: GPI-anchored protein LORELEI-like... 57 3e-06 ref|XP_002531773.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 dbj|BAF46300.1| GPI-anchored protein [Ipomoea nil] 57 4e-06 ref|XP_003618900.1| GPI-anchored protein [Medicago truncatula] g... 56 6e-06 ref|XP_006378004.1| hypothetical protein POPTR_0011s17150g, part... 56 7e-06 ref|XP_002531774.1| conserved hypothetical protein [Ricinus comm... 56 7e-06 gb|EYU28594.1| hypothetical protein MIMGU_mgv1a015213mg [Mimulus... 55 1e-05 gb|EPS65032.1| hypothetical protein M569_09746, partial [Genlise... 55 1e-05 >ref|XP_007132663.1| hypothetical protein PHAVU_011G114300g [Phaseolus vulgaris] gi|561005663|gb|ESW04657.1| hypothetical protein PHAVU_011G114300g [Phaseolus vulgaris] Length = 167 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCC 560 AC +D ENQNYTV+TSQCKGP YPP+ CC Sbjct: 47 ACAVDFENQNYTVLTSQCKGPQYPPKVCC 75 >ref|XP_003540907.2| PREDICTED: GPI-anchored protein LORELEI-like [Glycine max] Length = 174 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCC 560 AC +D ENQNYTV+TSQCKGP YPP+ CC Sbjct: 53 ACGVDFENQNYTVLTSQCKGPQYPPKVCC 81 >ref|XP_004294295.1| PREDICTED: GPI-anchored protein LORELEI-like [Fragaria vesca subsp. vesca] Length = 173 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/29 (68%), Positives = 27/29 (93%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCC 560 +CP++ ENQNYTV+TS+CKGP+YPP+ CC Sbjct: 54 SCPVNFENQNYTVLTSKCKGPNYPPKICC 82 >ref|XP_002531773.1| conserved hypothetical protein [Ricinus communis] gi|223528609|gb|EEF30629.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCCS 563 ACP++ E QNYT+ITSQCKGP YPP+ CC+ Sbjct: 55 ACPVNFEFQNYTIITSQCKGPKYPPKTCCA 84 >dbj|BAF46300.1| GPI-anchored protein [Ipomoea nil] Length = 170 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCC 560 ACP++ E QNYTVITSQCKGP YPP+ CC Sbjct: 50 ACPVNFEVQNYTVITSQCKGPQYPPKLCC 78 >ref|XP_003618900.1| GPI-anchored protein [Medicago truncatula] gi|355493915|gb|AES75118.1| GPI-anchored protein [Medicago truncatula] Length = 178 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCC 560 AC +D ENQNYT+ITSQCK P YPP+ CC Sbjct: 55 ACKVDFENQNYTIITSQCKAPRYPPKSCC 83 >ref|XP_006378004.1| hypothetical protein POPTR_0011s17150g, partial [Populus trichocarpa] gi|550328610|gb|ERP55801.1| hypothetical protein POPTR_0011s17150g, partial [Populus trichocarpa] Length = 354 Score = 55.8 bits (133), Expect = 7e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +3 Query: 462 AYSTACPIDIENQNYTVITSQCKGPDYPPEPCC 560 A S ACP+ E NYT+ITSQCKGP YPP CC Sbjct: 5 ALSAACPVSFEFLNYTIITSQCKGPQYPPSRCC 37 >ref|XP_002531774.1| conserved hypothetical protein [Ricinus communis] gi|223528610|gb|EEF30630.1| conserved hypothetical protein [Ricinus communis] Length = 168 Score = 55.8 bits (133), Expect = 7e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +3 Query: 474 ACPIDIENQNYTVITSQCKGPDYPPEPCCS 563 ACP++ E QNYTVITSQCKGP Y PE CC+ Sbjct: 51 ACPVNFEFQNYTVITSQCKGPKYAPETCCA 80 >gb|EYU28594.1| hypothetical protein MIMGU_mgv1a015213mg [Mimulus guttatus] Length = 164 Score = 55.5 bits (132), Expect = 1e-05 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +3 Query: 471 TACPIDIENQNYTVITSQCKGPDYPPEPCC 560 ++C +D EN NYTVITSQCKGP+Y PE CC Sbjct: 45 SSCSVDFENMNYTVITSQCKGPNYSPERCC 74 >gb|EPS65032.1| hypothetical protein M569_09746, partial [Genlisea aurea] Length = 106 Score = 55.5 bits (132), Expect = 1e-05 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +3 Query: 471 TACPIDIENQNYTVITSQCKGPDYPPEPCCS 563 T+C +D E+ NYTVITSQCKGP+Y PE CC+ Sbjct: 15 TSCSVDFEHMNYTVITSQCKGPNYSPERCCA 45