BLASTX nr result
ID: Mentha22_contig00015670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00015670 (730 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30152.1| hypothetical protein MIMGU_mgv1a003220mg [Mimulus... 60 8e-07 gb|EPS57912.1| hypothetical protein M569_16905 [Genlisea aurea] 59 2e-06 >gb|EYU30152.1| hypothetical protein MIMGU_mgv1a003220mg [Mimulus guttatus] Length = 598 Score = 60.1 bits (144), Expect = 8e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +2 Query: 473 TLPMEISRIEYFLEEVYAGGSLRSTTTIGNDKEQEQVYVLYF 598 TLP+E S ++YF++E+YAG SLRSTTT+GNDKE+E+VY F Sbjct: 191 TLPVEKSPMKYFMDEMYAGNSLRSTTTLGNDKERERVYDTIF 232 >gb|EPS57912.1| hypothetical protein M569_16905 [Genlisea aurea] Length = 265 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = +2 Query: 470 DTLPMEISRIEYFLEEVYAGGSLRSTTTIGNDKEQEQVYVLYF 598 +T P+E S ++YF+EE+YAG SLRSTT++GNDKE+E+VY F Sbjct: 180 ETAPIEYSPMKYFMEEMYAGNSLRSTTSMGNDKERERVYDTIF 222