BLASTX nr result
ID: Mentha22_contig00015329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00015329 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22141.1| hypothetical protein MIMGU_mgv1a007249mg [Mimulus... 74 2e-11 >gb|EYU22141.1| hypothetical protein MIMGU_mgv1a007249mg [Mimulus guttatus] Length = 413 Score = 73.9 bits (180), Expect = 2e-11 Identities = 46/77 (59%), Positives = 53/77 (68%), Gaps = 5/77 (6%) Frame = +2 Query: 212 MSVLHQAIPPLS--RFQCFS-AAHHRFTPRYGV-KNPSFQASFGVECLNF-PPSALPNSI 376 MS LHQ LS R Q S +H+FTP++ V KNP F A FG++C PPSALPNS Sbjct: 1 MSALHQNPLCLSPRRLQHLSITTNHQFTPQFEVVKNPFFHAPFGIKCSTLCPPSALPNSS 60 Query: 377 DHASPVSSFSQLIEALI 427 HASPVSSFSQLIE+LI Sbjct: 61 SHASPVSSFSQLIESLI 77