BLASTX nr result
ID: Mentha22_contig00015039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00015039 (529 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007052542.1| ADP/ATP carrier 2 [Theobroma cacao] gi|50870... 65 1e-08 ref|XP_004291800.1| PREDICTED: ADP,ATP carrier protein, mitochon... 64 2e-08 ref|XP_004229620.1| PREDICTED: ADP,ATP carrier protein, mitochon... 64 2e-08 sp|O22342.1|ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1, ... 64 2e-08 ref|XP_006470591.1| PREDICTED: ADP,ATP carrier protein, mitochon... 64 2e-08 ref|XP_006446100.1| hypothetical protein CICLE_v10017600mg [Citr... 64 2e-08 ref|NP_001234018.1| ADP/ATP translocator [Solanum lycopersicum] ... 64 2e-08 gb|ABB55387.1| ADP,ATP carrier protein precursor-like [Solanum t... 64 2e-08 ref|NP_001275285.1| ADP,ATP carrier protein, mitochondrial [Sola... 64 2e-08 ref|XP_002285503.1| PREDICTED: ADP,ATP carrier protein, mitochon... 64 2e-08 emb|CBI16399.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_006345460.1| PREDICTED: ADP,ATP carrier protein, mitochon... 64 3e-08 ref|XP_007014994.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao... 64 3e-08 ref|XP_004136845.1| PREDICTED: ADP,ATP carrier protein 3, mitoch... 64 3e-08 ref|XP_002275525.2| PREDICTED: ADP,ATP carrier protein 3, mitoch... 64 3e-08 emb|CBI21876.3| unnamed protein product [Vitis vinifera] 64 3e-08 emb|CAN66307.1| hypothetical protein VITISV_009087 [Vitis vinifera] 64 3e-08 ref|XP_006399841.1| hypothetical protein EUTSA_v10013800mg [Eutr... 63 4e-08 ref|XP_006399840.1| hypothetical protein EUTSA_v10013800mg [Eutr... 63 4e-08 ref|XP_006379099.1| ADP family protein [Populus trichocarpa] gi|... 63 4e-08 >ref|XP_007052542.1| ADP/ATP carrier 2 [Theobroma cacao] gi|508704803|gb|EOX96699.1| ADP/ATP carrier 2 [Theobroma cacao] Length = 507 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVLAGYDKLQL+VLGKKYGSGGA Sbjct: 475 ANILRAIAGAGVLAGYDKLQLIVLGKKYGSGGA 507 >ref|XP_004291800.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 394 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVLAGYDKLQ+LVLGKKYGSGGA Sbjct: 362 ANILRAIAGAGVLAGYDKLQVLVLGKKYGSGGA 394 >ref|XP_004229620.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum lycopersicum] Length = 375 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVL+GYDKLQLLVLGKKYGSGGA Sbjct: 343 ANILRAIAGAGVLSGYDKLQLLVLGKKYGSGGA 375 >sp|O22342.1|ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide translocator 1; Short=ANT 1; Flags: Precursor gi|2463664|gb|AAB72047.1| adenine nucleotide translocator 1 [Gossypium hirsutum] Length = 386 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 SNILRAIAGAGVLAGYDKLQL+V GKKYGSGGA Sbjct: 354 SNILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA 386 >ref|XP_006470591.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Citrus sinensis] Length = 394 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVLAGYDKLQ++VLGKKYGSGGA Sbjct: 362 ANILRAIAGAGVLAGYDKLQMIVLGKKYGSGGA 394 >ref|XP_006446100.1| hypothetical protein CICLE_v10017600mg [Citrus clementina] gi|557548711|gb|ESR59340.1| hypothetical protein CICLE_v10017600mg [Citrus clementina] Length = 394 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVLAGYDKLQ++VLGKKYGSGGA Sbjct: 362 ANILRAIAGAGVLAGYDKLQMIVLGKKYGSGGA 394 >ref|NP_001234018.1| ADP/ATP translocator [Solanum lycopersicum] gi|1890116|gb|AAB49700.1| ADP/ATP translocator [Solanum lycopersicum] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRA+AGAGVLAGYDKLQ+LVLGKKYGSGGA Sbjct: 354 ANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA 386 >gb|ABB55387.1| ADP,ATP carrier protein precursor-like [Solanum tuberosum] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRA+AGAGVLAGYDKLQ+LVLGKKYGSGGA Sbjct: 354 ANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA 386 >ref|NP_001275285.1| ADP,ATP carrier protein, mitochondrial [Solanum tuberosum] gi|78191448|gb|ABB29945.1| ADP/ATP translocator-like [Solanum tuberosum] gi|82621182|gb|ABB86279.1| ADP,ATP carrier protein precursor-like [Solanum tuberosum] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRA+AGAGVLAGYDKLQ+LVLGKKYGSGGA Sbjct: 354 ANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA 386 >ref|XP_002285503.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Vitis vinifera] Length = 393 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRA+AGAGVLAGYDKLQ+LVLGKKYGSGGA Sbjct: 361 ANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA 393 >emb|CBI16399.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRA+AGAGVLAGYDKLQ+LVLGKKYGSGGA Sbjct: 264 ANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA 296 >ref|XP_006345460.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum tuberosum] Length = 378 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVL+GYDKLQL+VLGKKYGSGGA Sbjct: 346 ANILRAIAGAGVLSGYDKLQLIVLGKKYGSGGA 378 >ref|XP_007014994.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] gi|590583787|ref|XP_007014995.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] gi|508785357|gb|EOY32613.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] gi|508785358|gb|EOY32614.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] Length = 391 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRA+AGAGVLAGYDKLQ++VLGKKYGSGGA Sbjct: 359 ANILRAVAGAGVLAGYDKLQMIVLGKKYGSGGA 391 >ref|XP_004136845.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis sativus] gi|449526257|ref|XP_004170130.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis sativus] Length = 378 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGG 116 +NILRA+AGAGVLAGYDKLQLLVLGKKYGSGG Sbjct: 345 ANILRAVAGAGVLAGYDKLQLLVLGKKYGSGG 376 >ref|XP_002275525.2| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Vitis vinifera] Length = 415 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGG 116 +NILRA+AGAGVLAGYDKLQLLVLGKKYGSGG Sbjct: 382 ANILRAVAGAGVLAGYDKLQLLVLGKKYGSGG 413 >emb|CBI21876.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGG 116 +NILRA+AGAGVLAGYDKLQLLVLGKKYGSGG Sbjct: 216 ANILRAVAGAGVLAGYDKLQLLVLGKKYGSGG 247 >emb|CAN66307.1| hypothetical protein VITISV_009087 [Vitis vinifera] Length = 383 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGG 116 +NILRA+AGAGVLAGYDKLQLLVLGKKYGSGG Sbjct: 350 ANILRAVAGAGVLAGYDKLQLLVLGKKYGSGG 381 >ref|XP_006399841.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum] gi|557100931|gb|ESQ41294.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum] Length = 352 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVL+GYDKLQLL+LGKKYGSGGA Sbjct: 320 ANILRAIAGAGVLSGYDKLQLLLLGKKYGSGGA 352 >ref|XP_006399840.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum] gi|557100930|gb|ESQ41293.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum] Length = 323 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVL+GYDKLQLL+LGKKYGSGGA Sbjct: 291 ANILRAIAGAGVLSGYDKLQLLLLGKKYGSGGA 323 >ref|XP_006379099.1| ADP family protein [Populus trichocarpa] gi|550331187|gb|ERP56896.1| ADP family protein [Populus trichocarpa] Length = 385 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 21 SNILRAIAGAGVLAGYDKLQLLVLGKKYGSGGA 119 +NILRAIAGAGVLAGYDKLQL+V GKKYGSGGA Sbjct: 353 ANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA 385