BLASTX nr result
ID: Mentha22_contig00014745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00014745 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28374.1| hypothetical protein MIMGU_mgv1a005889mg [Mimulus... 69 5e-10 ref|XP_006342326.1| PREDICTED: U-box domain-containing protein 3... 66 6e-09 ref|XP_006342325.1| PREDICTED: U-box domain-containing protein 3... 66 6e-09 ref|XP_003633112.1| PREDICTED: U-box domain-containing protein 3... 66 6e-09 emb|CBI27875.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002514100.1| ATP binding protein, putative [Ricinus commu... 65 1e-08 ref|XP_002309208.2| hypothetical protein POPTR_0006s14900g [Popu... 64 2e-08 ref|XP_004507961.1| PREDICTED: U-box domain-containing protein 3... 64 2e-08 ref|XP_003550626.1| PREDICTED: U-box domain-containing protein 3... 64 2e-08 ref|XP_007154626.1| hypothetical protein PHAVU_003G134500g [Phas... 64 2e-08 ref|XP_004243743.1| PREDICTED: U-box domain-containing protein 3... 63 4e-08 ref|XP_004287584.1| PREDICTED: U-box domain-containing protein 3... 62 1e-07 ref|XP_006353585.1| PREDICTED: U-box domain-containing protein 3... 61 1e-07 ref|XP_007012759.1| U-box domain-containing protein kinase famil... 60 2e-07 ref|XP_006475494.1| PREDICTED: U-box domain-containing protein 3... 60 4e-07 ref|XP_006451528.1| hypothetical protein CICLE_v10007527mg [Citr... 60 4e-07 ref|XP_007204644.1| hypothetical protein PRUPE_ppa001685mg [Prun... 60 4e-07 ref|XP_004252067.1| PREDICTED: U-box domain-containing protein 3... 60 4e-07 ref|XP_004141173.1| PREDICTED: U-box domain-containing protein 3... 60 4e-07 ref|XP_004157961.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain... 59 5e-07 >gb|EYU28374.1| hypothetical protein MIMGU_mgv1a005889mg [Mimulus guttatus] Length = 466 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQ 239 AIKAWLDRHDVSPVT++KLQ K L PN+ LHSAIQEW++ Sbjct: 425 AIKAWLDRHDVSPVTREKLQNKTLTPNYMLHSAIQEWRK 463 >ref|XP_006342326.1| PREDICTED: U-box domain-containing protein 34-like isoform X2 [Solanum tuberosum] Length = 666 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWK 242 AIKAW+DRH+VSPVTK LQ KML PNHTLH AIQ+W+ Sbjct: 627 AIKAWVDRHNVSPVTKHILQHKMLTPNHTLHLAIQDWR 664 >ref|XP_006342325.1| PREDICTED: U-box domain-containing protein 34-like isoform X1 [Solanum tuberosum] Length = 745 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWK 242 AIKAW+DRH+VSPVTK LQ KML PNHTLH AIQ+W+ Sbjct: 706 AIKAWVDRHNVSPVTKHILQHKMLTPNHTLHLAIQDWR 743 >ref|XP_003633112.1| PREDICTED: U-box domain-containing protein 34-like [Vitis vinifera] Length = 791 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSVKPA*N 218 AIKAWLDRHDVSPVTK Q KML PN TL SAIQEW+ V+ + N Sbjct: 746 AIKAWLDRHDVSPVTKWTFQHKMLTPNQTLRSAIQEWRCRVESSSN 791 >emb|CBI27875.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSVKPA*N 218 AIKAWLDRHDVSPVTK Q KML PN TL SAIQEW+ V+ + N Sbjct: 724 AIKAWLDRHDVSPVTKWTFQHKMLTPNQTLRSAIQEWRCRVESSSN 769 >ref|XP_002514100.1| ATP binding protein, putative [Ricinus communis] gi|223546556|gb|EEF48054.1| ATP binding protein, putative [Ricinus communis] Length = 778 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL RH+VSPVTK +LQ ML PNHTL SAIQEW+ V Sbjct: 733 AIKAWLGRHNVSPVTKLRLQHSMLTPNHTLRSAIQEWRSRV 773 >ref|XP_002309208.2| hypothetical protein POPTR_0006s14900g [Populus trichocarpa] gi|550336370|gb|EEE92731.2| hypothetical protein POPTR_0006s14900g [Populus trichocarpa] Length = 707 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWLDRH++SPVTK + Q +L PNHTL SAIQEW+ V Sbjct: 662 AIKAWLDRHNISPVTKLRFQHSILTPNHTLRSAIQEWRSRV 702 >ref|XP_004507961.1| PREDICTED: U-box domain-containing protein 34-like [Cicer arietinum] Length = 764 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL +H+VSPVTK KL LIPNHTL SAIQEWK V Sbjct: 720 AIKAWLSKHNVSPVTKHKLLHSELIPNHTLRSAIQEWKSGV 760 >ref|XP_003550626.1| PREDICTED: U-box domain-containing protein 34-like [Glycine max] Length = 760 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL +H+VSP+TK KLQ +L PNHTL SAIQEWK V Sbjct: 718 AIKAWLSKHNVSPMTKLKLQHSVLTPNHTLRSAIQEWKSGV 758 >ref|XP_007154626.1| hypothetical protein PHAVU_003G134500g [Phaseolus vulgaris] gi|561027980|gb|ESW26620.1| hypothetical protein PHAVU_003G134500g [Phaseolus vulgaris] Length = 763 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL +H+VSP+TK KLQ +L PNHTL SAIQEWK + Sbjct: 721 AIKAWLSKHNVSPMTKLKLQHSVLTPNHTLRSAIQEWKSGI 761 >ref|XP_004243743.1| PREDICTED: U-box domain-containing protein 34-like [Solanum lycopersicum] Length = 746 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWK 242 AIKAW+DRH++SPVTKQ LQ KML PN TLH AIQ+W+ Sbjct: 707 AIKAWVDRHNISPVTKQILQHKMLTPNLTLHLAIQDWR 744 >ref|XP_004287584.1| PREDICTED: U-box domain-containing protein 34-like [Fragaria vesca subsp. vesca] Length = 753 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWK 242 AIKAWLD+H+VSPVT+ +LQ L PNHTL SAIQEW+ Sbjct: 711 AIKAWLDKHNVSPVTRLRLQHSELTPNHTLRSAIQEWR 748 >ref|XP_006353585.1| PREDICTED: U-box domain-containing protein 34-like [Solanum tuberosum] Length = 789 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQS 236 AIK WLDR+ VSP+TKQ+LQ K++ PNHTL AIQEW+ + Sbjct: 741 AIKLWLDRYSVSPMTKQRLQHKLVTPNHTLRLAIQEWRST 780 >ref|XP_007012759.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|590575697|ref|XP_007012760.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508783122|gb|EOY30378.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508783123|gb|EOY30379.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] Length = 752 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL +H+VSPVTK +LQ +L PN TL SAIQEWK V Sbjct: 707 AIKAWLQKHNVSPVTKCRLQHSVLTPNQTLRSAIQEWKSRV 747 >ref|XP_006475494.1| PREDICTED: U-box domain-containing protein 34-like [Citrus sinensis] Length = 769 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL++H+VSPVTK +LQ +IPN+TL SAIQ+W+ V Sbjct: 726 AIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAIQQWRSPV 766 >ref|XP_006451528.1| hypothetical protein CICLE_v10007527mg [Citrus clementina] gi|557554754|gb|ESR64768.1| hypothetical protein CICLE_v10007527mg [Citrus clementina] Length = 769 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL++H+VSPVTK +LQ +IPN+TL SAIQ+W+ V Sbjct: 726 AIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAIQQWRSPV 766 >ref|XP_007204644.1| hypothetical protein PRUPE_ppa001685mg [Prunus persica] gi|462400175|gb|EMJ05843.1| hypothetical protein PRUPE_ppa001685mg [Prunus persica] Length = 780 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL++H+VSPVT+ +L+ L PNHTL SAIQEW+ V Sbjct: 735 AIKAWLEKHNVSPVTRLRLKHSALTPNHTLRSAIQEWRTHV 775 >ref|XP_004252067.1| PREDICTED: U-box domain-containing protein 34-like [Solanum lycopersicum] Length = 760 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQS 236 AIK W DR+ VSP+TKQ+LQ K++ PNHTL AIQEW+ + Sbjct: 712 AIKLWFDRYSVSPMTKQRLQHKLVTPNHTLRLAIQEWRST 751 >ref|XP_004141173.1| PREDICTED: U-box domain-containing protein 34-like [Cucumis sativus] Length = 727 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL++HDVSP TK KL+ IPN+TL SAI+EW+ V Sbjct: 682 AIKAWLEKHDVSPATKLKLRHSFFIPNYTLRSAIREWRSRV 722 >ref|XP_004157961.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 34-like [Cucumis sativus] Length = 727 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 355 AIKAWLDRHDVSPVTKQKLQTKMLIPNHTLHSAIQEWKQSV 233 AIKAWL++HDVSP TK KL+ L PN+TL SAI+EW+ V Sbjct: 682 AIKAWLEKHDVSPATKLKLRHSFLXPNYTLRSAIREWRSRV 722