BLASTX nr result
ID: Mentha22_contig00013175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013175 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38820.1| hypothetical protein MIMGU_mgv1a011279mg [Mimulus... 89 8e-16 ref|XP_004249251.1| PREDICTED: transmembrane protein 19-like [So... 81 2e-13 ref|XP_006351300.1| PREDICTED: transmembrane protein 19-like [So... 80 3e-13 ref|XP_007202527.1| hypothetical protein PRUPE_ppa010966mg [Prun... 79 9e-13 ref|XP_002284876.1| PREDICTED: transmembrane protein 19 [Vitis v... 78 1e-12 ref|XP_007013286.1| Integral membrane protein-like isoform 3 [Th... 78 1e-12 ref|XP_007013284.1| Integral membrane protein-like isoform 1 [Th... 78 1e-12 ref|XP_002515562.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 gb|EXB76245.1| Transmembrane protein 19 [Morus notabilis] 75 1e-11 ref|XP_004149856.1| PREDICTED: transmembrane protein 19-like [Cu... 72 6e-11 ref|XP_004287388.1| PREDICTED: transmembrane protein 19-like [Fr... 72 8e-11 ref|XP_002324403.2| hypothetical protein POPTR_0018s06340g [Popu... 71 2e-10 gb|EPS66994.1| hypothetical protein M569_07781 [Genlisea aurea] 68 2e-09 ref|XP_002873974.1| integral membrane family protein [Arabidopsi... 66 6e-09 ref|XP_006286617.1| hypothetical protein CARUB_v10002408mg [Caps... 62 6e-08 ref|NP_568386.1| uncharacterized protein [Arabidopsis thaliana] ... 62 6e-08 ref|XP_003549793.1| PREDICTED: transmembrane protein 19-like [Gl... 62 6e-08 gb|AAM61603.1| unknown [Arabidopsis thaliana] 62 6e-08 ref|XP_006400557.1| hypothetical protein EUTSA_v10014278mg [Eutr... 62 8e-08 ref|XP_006475759.1| PREDICTED: transmembrane protein 19-like [Ci... 62 1e-07 >gb|EYU38820.1| hypothetical protein MIMGU_mgv1a011279mg [Mimulus guttatus] Length = 287 Score = 88.6 bits (218), Expect = 8e-16 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 ME NLVQP +AA +SAAI+ RSYRKKSLD SGA +GFAVMTIH AVNYRFGA+LL F+ Sbjct: 1 MENNLVQPLIAAIISAAIAARSYRKKSLDFSGAISGFAVMTIHIAVNYRFGAVLLVFF 58 >ref|XP_004249251.1| PREDICTED: transmembrane protein 19-like [Solanum lycopersicum] Length = 287 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 MEK+L+QP VAA LS+ I+FRSY++KSL+LSGA AG VM IH AVNYRFGA+LL F+ Sbjct: 1 MEKHLIQPAVAAVLSSVIAFRSYKRKSLNLSGAIAGVIVMFIHLAVNYRFGAMLLVFF 58 >ref|XP_006351300.1| PREDICTED: transmembrane protein 19-like [Solanum tuberosum] Length = 287 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/58 (68%), Positives = 48/58 (82%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 MEK+L+QP VAA LS+ I+FRSY++KSL LSGA AG VM IH AVNYRFGA+LL F+ Sbjct: 1 MEKHLIQPAVAALLSSVIAFRSYKRKSLSLSGAIAGVIVMFIHLAVNYRFGAMLLVFF 58 >ref|XP_007202527.1| hypothetical protein PRUPE_ppa010966mg [Prunus persica] gi|462398058|gb|EMJ03726.1| hypothetical protein PRUPE_ppa010966mg [Prunus persica] Length = 228 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/59 (62%), Positives = 49/59 (83%) Frame = -3 Query: 178 DMEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 +M+K L+QP +A +S+ I+ R+YR+KSLDLSGA AGFAVMTIH A+ YR+GALLL F+ Sbjct: 6 NMDKLLIQPLIALLISSLIAARAYRRKSLDLSGAIAGFAVMTIHIAIGYRYGALLLVFF 64 >ref|XP_002284876.1| PREDICTED: transmembrane protein 19 [Vitis vinifera] gi|297738884|emb|CBI28129.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/58 (63%), Positives = 46/58 (79%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 ME +QP +A SAAI+ RS+R+KSLDLSGAFAGFAV+TIH V YR+GA+LL F+ Sbjct: 1 MENFPIQPIIAILFSAAIAIRSFRRKSLDLSGAFAGFAVLTIHFGVGYRYGAMLLAFF 58 >ref|XP_007013286.1| Integral membrane protein-like isoform 3 [Theobroma cacao] gi|508783649|gb|EOY30905.1| Integral membrane protein-like isoform 3 [Theobroma cacao] Length = 248 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 MEK L+QP +A +S I+ RSY +KSLDLSGA +GF VMTIH AV YRFGA+LL F+ Sbjct: 1 MEKTLIQPLIAMLISFLIAIRSYGRKSLDLSGALSGFIVMTIHFAVGYRFGAMLLAFF 58 >ref|XP_007013284.1| Integral membrane protein-like isoform 1 [Theobroma cacao] gi|590577624|ref|XP_007013285.1| Integral membrane protein-like isoform 1 [Theobroma cacao] gi|508783647|gb|EOY30903.1| Integral membrane protein-like isoform 1 [Theobroma cacao] gi|508783648|gb|EOY30904.1| Integral membrane protein-like isoform 1 [Theobroma cacao] Length = 287 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 MEK L+QP +A +S I+ RSY +KSLDLSGA +GF VMTIH AV YRFGA+LL F+ Sbjct: 1 MEKTLIQPLIAMLISFLIAIRSYGRKSLDLSGALSGFIVMTIHFAVGYRFGAMLLAFF 58 >ref|XP_002515562.1| conserved hypothetical protein [Ricinus communis] gi|223545506|gb|EEF47011.1| conserved hypothetical protein [Ricinus communis] Length = 271 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/58 (58%), Positives = 48/58 (82%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 ME N++QP + A +S+ I+ R+Y++KSL+LSGA AGF VMTIH AV+YRFGA++L F+ Sbjct: 1 MEGNIIQPLIGALISSTIAIRAYKRKSLNLSGAIAGFLVMTIHFAVSYRFGAIILAFF 58 >gb|EXB76245.1| Transmembrane protein 19 [Morus notabilis] Length = 311 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/58 (58%), Positives = 47/58 (81%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 ME+ L+QP +A +S+ I+ R+YR+KSLDLSGA +GF VM+IH AV YR+GAL+L F+ Sbjct: 1 MERTLMQPLIAVLISSLIAIRAYRRKSLDLSGAISGFIVMSIHIAVGYRYGALILVFF 58 >ref|XP_004149856.1| PREDICTED: transmembrane protein 19-like [Cucumis sativus] gi|449508273|ref|XP_004163269.1| PREDICTED: transmembrane protein 19-like [Cucumis sativus] Length = 287 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/58 (56%), Positives = 47/58 (81%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 M+ L+QP VA +++ I+FR+YR+KSL+LSGA AGF VM+ H A+NYR+GA+LL F+ Sbjct: 1 MDNILIQPSVAVIIASIIAFRAYRRKSLNLSGALAGFIVMSTHFAINYRYGAVLLVFF 58 >ref|XP_004287388.1| PREDICTED: transmembrane protein 19-like [Fragaria vesca subsp. vesca] Length = 287 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 M+ +L+QP +A +SA ++ R+YR+KSLD SGA AG AVMT+H AV YR+GA+LL F+ Sbjct: 1 MDSHLIQPLIAFLISAFVAARAYRRKSLDFSGAVAGLAVMTLHIAVGYRYGAVLLVFF 58 >ref|XP_002324403.2| hypothetical protein POPTR_0018s06340g [Populus trichocarpa] gi|550318158|gb|EEF02968.2| hypothetical protein POPTR_0018s06340g [Populus trichocarpa] Length = 287 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 ME ++QP VA +S I+ ++YR+KSLD++GA AGF VMT+H A++YRFGA+LL F+ Sbjct: 1 MENVVIQPSVAVLISFVIAIKAYRRKSLDVTGAVAGFIVMTLHFAISYRFGAILLVFF 58 >gb|EPS66994.1| hypothetical protein M569_07781 [Genlisea aurea] Length = 289 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 + L Q +A +S+A+S R+Y KKSLDL GA +GF +MTIH A+NYR+GA+LL F+ Sbjct: 2 VSSGLFQFTIAVLISSAVSVRAYIKKSLDLGGAISGFLIMTIHIAINYRYGAILLAFF 59 >ref|XP_002873974.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata] gi|297319811|gb|EFH50233.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata] Length = 288 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -3 Query: 148 VAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 VAA +S+ I+FRSY++KSLDLSG AGF VMTIH +R+GALLL F+ Sbjct: 11 VAAVISSLIAFRSYKRKSLDLSGGIAGFLVMTIHFTAGFRYGALLLVFF 59 >ref|XP_006286617.1| hypothetical protein CARUB_v10002408mg [Capsella rubella] gi|482555323|gb|EOA19515.1| hypothetical protein CARUB_v10002408mg [Capsella rubella] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 148 VAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 +A LS+ I+FRSY+++SLDLSG AGF VMTIH +R+GALLL F+ Sbjct: 11 LAVILSSLIAFRSYKRRSLDLSGGIAGFLVMTIHFTAGFRYGALLLVFF 59 >ref|NP_568386.1| uncharacterized protein [Arabidopsis thaliana] gi|334187781|ref|NP_001190343.1| uncharacterized protein [Arabidopsis thaliana] gi|110738248|dbj|BAF01053.1| hypothetical protein [Arabidopsis thaliana] gi|332005384|gb|AED92767.1| uncharacterized protein AT5G19930 [Arabidopsis thaliana] gi|332005385|gb|AED92768.1| uncharacterized protein AT5G19930 [Arabidopsis thaliana] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -3 Query: 145 AAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 A +S+ I+FRSY++KSLDLSG AGF VMTIH +R+GALLL F+ Sbjct: 12 AVIISSLIAFRSYKRKSLDLSGGIAGFLVMTIHFTAGFRYGALLLVFF 59 >ref|XP_003549793.1| PREDICTED: transmembrane protein 19-like [Glycine max] Length = 293 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = -3 Query: 166 NLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 + +Q F+A ++ +I+FR++RKKSL SGA AGF VM +H V YRFGA+LL F+ Sbjct: 8 DFLQLFIAVFIAFSIAFRAHRKKSLSTSGAIAGFFVMALHIFVGYRFGAMLLAFF 62 >gb|AAM61603.1| unknown [Arabidopsis thaliana] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -3 Query: 145 AAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 A +S+ I+FRSY++KSLDLSG AGF VMTIH +R+GALLL F+ Sbjct: 12 AVIISSLIAFRSYKRKSLDLSGGIAGFLVMTIHFTAGFRYGALLLVFF 59 >ref|XP_006400557.1| hypothetical protein EUTSA_v10014278mg [Eutrema salsugineum] gi|557101647|gb|ESQ42010.1| hypothetical protein EUTSA_v10014278mg [Eutrema salsugineum] Length = 288 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -3 Query: 145 AAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 A +S+ I+FRSY++KSLDLSG AGF VMTIH +R+GALLL F+ Sbjct: 12 AVLISSLIAFRSYKRKSLDLSGGVAGFLVMTIHFTAGFRYGALLLVFF 59 >ref|XP_006475759.1| PREDICTED: transmembrane protein 19-like [Citrus sinensis] Length = 287 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = -3 Query: 175 MEKNLVQPFVAAALSAAISFRSYRKKSLDLSGAFAGFAVMTIHGAVNYRFGALLLGFY 2 ME L Q +A +S+ I+ RSYR+KSL+ SGA +GF VMT H A RFGALLL F+ Sbjct: 1 METFLNQTLIAVLISSLIAIRSYRRKSLNFSGAVSGFIVMTAHIAAGSRFGALLLVFF 58