BLASTX nr result
ID: Mentha22_contig00013059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013059 (689 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43251.1| hypothetical protein MIMGU_mgv1a009225mg [Mimulus... 69 1e-09 ref|XP_006364883.1| PREDICTED: putative ALA-interacting subunit ... 64 6e-08 ref|XP_004244863.1| PREDICTED: putative ALA-interacting subunit ... 62 2e-07 >gb|EYU43251.1| hypothetical protein MIMGU_mgv1a009225mg [Mimulus guttatus] Length = 349 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = +2 Query: 2 LGIAYISIGSTFMFVAFLFLLLHIQNPRSYVDTSNISWNGKHVS 133 LGIAYISIG++ +F+AF+FLLLH+ NPR Y DTSN+SWN K +S Sbjct: 305 LGIAYISIGTSLIFIAFVFLLLHVNNPRPYGDTSNLSWNWKPIS 348 >ref|XP_006364883.1| PREDICTED: putative ALA-interacting subunit 2-like isoform X1 [Solanum tuberosum] gi|565398647|ref|XP_006364884.1| PREDICTED: putative ALA-interacting subunit 2-like isoform X2 [Solanum tuberosum] gi|565398649|ref|XP_006364885.1| PREDICTED: putative ALA-interacting subunit 2-like isoform X3 [Solanum tuberosum] gi|565398651|ref|XP_006364886.1| PREDICTED: putative ALA-interacting subunit 2-like isoform X4 [Solanum tuberosum] Length = 351 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/45 (60%), Positives = 41/45 (91%) Frame = +2 Query: 2 LGIAYISIGSTFMFVAFLFLLLHIQNPRSYVDTSNISWNGKHVSD 136 LG++Y+++GS+F+F+AF+FLLLH++NPRSY DT N+SWN K +S+ Sbjct: 308 LGMSYVAVGSSFIFLAFVFLLLHVKNPRSYGDT-NLSWNWKGMSN 351 >ref|XP_004244863.1| PREDICTED: putative ALA-interacting subunit 2-like [Solanum lycopersicum] Length = 351 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/45 (57%), Positives = 40/45 (88%) Frame = +2 Query: 2 LGIAYISIGSTFMFVAFLFLLLHIQNPRSYVDTSNISWNGKHVSD 136 LG++Y+++GS+F+F+AF+FLLLH++NPR Y DT N+SWN K +S+ Sbjct: 308 LGMSYVTVGSSFIFLAFVFLLLHVKNPRPYGDT-NLSWNWKGMSN 351