BLASTX nr result
ID: Mentha22_contig00012127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00012127 (523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42536.1| hypothetical protein MIMGU_mgv1a014563mg [Mimulus... 60 3e-07 >gb|EYU42536.1| hypothetical protein MIMGU_mgv1a014563mg [Mimulus guttatus] Length = 186 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 317 VVKHERQRSRNNATVNSGISKSRGWQPSLKAISEAAS 207 V ++ERQRSRNN VNSG+SKSRGWQPSL +ISEA S Sbjct: 150 VKQNERQRSRNNTRVNSGVSKSRGWQPSLNSISEAGS 186