BLASTX nr result
ID: Mentha22_contig00011368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011368 (552 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35637.1| hypothetical protein MIMGU_mgv1a012624mg [Mimulus... 69 6e-10 >gb|EYU35637.1| hypothetical protein MIMGU_mgv1a012624mg [Mimulus guttatus] Length = 245 Score = 69.3 bits (168), Expect = 6e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 550 HLEIDRSWNAYIVFSPEKYRERAAAPPSIKIPLLEASEQQMMELE 416 HLEIDR+WNA+IVF PE YR PPSIKIP+LEASE+ +M LE Sbjct: 200 HLEIDRNWNAFIVFCPENYRGTGVGPPSIKIPVLEASEEDIMALE 244