BLASTX nr result
ID: Mentha22_contig00011304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011304 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491322.1| PREDICTED: calcium-binding protein KIC-like ... 57 3e-06 ref|XP_006444792.1| hypothetical protein CICLE_v10022851mg [Citr... 57 3e-06 >ref|XP_006491322.1| PREDICTED: calcium-binding protein KIC-like [Citrus sinensis] Length = 157 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 106 TMEPDSEYEDLLPVMVDKLDGESFVAELCGGFRLL 2 T SEYEDLLPVM +KLD ESFV+ELCGGFRLL Sbjct: 43 TTSTGSEYEDLLPVMAEKLDVESFVSELCGGFRLL 77 >ref|XP_006444792.1| hypothetical protein CICLE_v10022851mg [Citrus clementina] gi|557547054|gb|ESR58032.1| hypothetical protein CICLE_v10022851mg [Citrus clementina] Length = 128 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 106 TMEPDSEYEDLLPVMVDKLDGESFVAELCGGFRLL 2 T SEYEDLLPVM +KLD ESFV+ELCGGFRLL Sbjct: 14 TTSTGSEYEDLLPVMAEKLDVESFVSELCGGFRLL 48