BLASTX nr result
ID: Mentha22_contig00010230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010230 (686 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42396.1| hypothetical protein MIMGU_mgv1a005103mg [Mimulus... 87 7e-15 >gb|EYU42396.1| hypothetical protein MIMGU_mgv1a005103mg [Mimulus guttatus] Length = 497 Score = 86.7 bits (213), Expect = 7e-15 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 3/75 (4%) Frame = -1 Query: 680 NDSRSQAVVPVPRPSLQSPK-NSLDIKGLEV-ADTTVKAKQNDHK-QTCYSARCLLRSDS 510 +DS+S+ V +PRP LQSPK +S DIKG E ++ T KA+Q D+ + CYSARCLLRSDS Sbjct: 423 SDSKSRRGVAIPRPRLQSPKKSSSDIKGQESNSNKTAKARQKDNSGKACYSARCLLRSDS 482 Query: 509 ISASKCIGVQGADYL 465 ISAS+C+GVQG+DY+ Sbjct: 483 ISASRCVGVQGSDYV 497