BLASTX nr result
ID: Mentha22_contig00009464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00009464 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Popu... 67 3e-09 ref|XP_003520929.1| PREDICTED: NADH--cytochrome b5 reductase 1 [... 67 3e-09 ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citr... 65 8e-09 ref|XP_004493245.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 65 1e-08 ref|XP_003554059.1| PREDICTED: NADH--cytochrome b5 reductase 1 [... 65 1e-08 gb|ACU19291.1| unknown [Glycine max] 64 2e-08 ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma ca... 64 2e-08 ref|XP_006339205.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 64 3e-08 ref|XP_004249368.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 64 3e-08 ref|XP_007204707.1| hypothetical protein PRUPE_ppa009801mg [Prun... 63 4e-08 emb|CAJ38394.1| cytochrome b5 reductase [Plantago major] 63 5e-08 gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus... 62 6e-08 ref|XP_003564467.1| PREDICTED: NADH-cytochrome b5 reductase 1-li... 62 6e-08 ref|XP_007161903.1| hypothetical protein PHAVU_001G107300g [Phas... 62 8e-08 ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Caps... 62 8e-08 ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Rici... 62 8e-08 ref|XP_004144304.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 62 1e-07 gb|AAV69020.1| NADH:cytochrome b5 reductase [Vernicia fordii] 62 1e-07 gb|EPS72506.1| hypothetical protein M569_02252, partial [Genlise... 61 2e-07 ref|XP_003624753.1| NADH cytochrome b5 reductase [Medicago trunc... 61 2e-07 >ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] gi|222857576|gb|EEE95123.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] Length = 280 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEALGYA E LFQF Sbjct: 248 DIKILRCGPPPMNKAMAAHLEALGYAPEMLFQF 280 >ref|XP_003520929.1| PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] Length = 278 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEALGYASE FQF Sbjct: 246 DIKILRCGPPPMNKAMAAHLEALGYASEMQFQF 278 >ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] gi|568862667|ref|XP_006484798.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Citrus sinensis] gi|557539455|gb|ESR50499.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] Length = 280 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+++LRCGPPPMNKAMAAHLEALGY SE LFQF Sbjct: 248 DIQVLRCGPPPMNKAMAAHLEALGYTSEMLFQF 280 >ref|XP_004493245.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cicer arietinum] Length = 278 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 DVKILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 246 DVKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >ref|XP_003554059.1| PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] Length = 278 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 246 DIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >gb|ACU19291.1| unknown [Glycine max] Length = 278 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 246 DIKILRCGPPPMNKAMAAHLEALGYAFEMQFQF 278 >ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao] gi|508785894|gb|EOY33150.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao] Length = 420 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMAAHLEALGY+SE FQF Sbjct: 388 DIQILRCGPPPMNKAMAAHLEALGYSSEMQFQF 420 >ref|XP_006339205.1| PREDICTED: NADH--cytochrome b5 reductase 1-like isoform X1 [Solanum tuberosum] gi|565344202|ref|XP_006339206.1| PREDICTED: NADH--cytochrome b5 reductase 1-like isoform X2 [Solanum tuberosum] Length = 278 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEALGY+ E FQF Sbjct: 246 DIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >ref|XP_004249368.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Solanum lycopersicum] Length = 278 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEALGY+ E FQF Sbjct: 246 DIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >ref|XP_007204707.1| hypothetical protein PRUPE_ppa009801mg [Prunus persica] gi|462400238|gb|EMJ05906.1| hypothetical protein PRUPE_ppa009801mg [Prunus persica] Length = 277 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 245 DIQILRCGPPPMNKAMAAHLEALGYAPEMQFQF 277 >emb|CAJ38394.1| cytochrome b5 reductase [Plantago major] Length = 195 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 DVK+LRCGPPPMNKAMAAHL+ALGY S+ FQF Sbjct: 163 DVKVLRCGPPPMNKAMAAHLDALGYTSDMQFQF 195 >gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus guttatus] Length = 280 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMA HLEALGY+SE FQF Sbjct: 248 DIQILRCGPPPMNKAMAGHLEALGYSSEMQFQF 280 >ref|XP_003564467.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Brachypodium distachyon] Length = 279 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMAAHLEALGY +E FQF Sbjct: 247 DIQILRCGPPPMNKAMAAHLEALGYTNEMQFQF 279 >ref|XP_007161903.1| hypothetical protein PHAVU_001G107300g [Phaseolus vulgaris] gi|561035367|gb|ESW33897.1| hypothetical protein PHAVU_001G107300g [Phaseolus vulgaris] Length = 278 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 DVKILRCGPPPMNKAMAAHLEAL YA E FQF Sbjct: 246 DVKILRCGPPPMNKAMAAHLEALEYAPEMQFQF 278 >ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] gi|482557103|gb|EOA21295.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] Length = 281 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMAA+LEALGY+ E LFQF Sbjct: 249 DIQILRCGPPPMNKAMAANLEALGYSQEMLFQF 281 >ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223533062|gb|EEF34822.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] Length = 279 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 DV+ILRCGPPPMNKAMAAHL ALGY SE FQF Sbjct: 247 DVQILRCGPPPMNKAMAAHLNALGYTSEMQFQF 279 >ref|XP_004144304.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] gi|449488287|ref|XP_004157991.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] Length = 281 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMAAHLE LGYA E LF F Sbjct: 249 DIQILRCGPPPMNKAMAAHLEELGYAPEMLFMF 281 >gb|AAV69020.1| NADH:cytochrome b5 reductase [Vernicia fordii] Length = 279 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 DV+ILRCGPPPMNKAMAAHL+ALGY S+ FQF Sbjct: 247 DVQILRCGPPPMNKAMAAHLDALGYTSQMQFQF 279 >gb|EPS72506.1| hypothetical protein M569_02252, partial [Genlisea aurea] Length = 194 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D++ILRCGPPPMNKAMA HL+ALGY SE FQF Sbjct: 162 DIQILRCGPPPMNKAMAGHLDALGYTSEMQFQF 194 >ref|XP_003624753.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|355499768|gb|AES80971.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|388520553|gb|AFK48338.1| unknown [Medicago truncatula] Length = 278 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 305 DVKILRCGPPPMNKAMAAHLEALGYASETLFQF 207 D+KILRCGPPPMNKAMAAHLEA+ YA E FQF Sbjct: 246 DIKILRCGPPPMNKAMAAHLEAIEYAPEMQFQF 278