BLASTX nr result
ID: Mentha22_contig00009366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00009366 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31942.1| hypothetical protein MIMGU_mgv1a026423mg [Mimulus... 55 8e-06 >gb|EYU31942.1| hypothetical protein MIMGU_mgv1a026423mg [Mimulus guttatus] Length = 487 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = -3 Query: 119 PWDIHPP-----PPDFLTNVFACQSQPMTMDSYSRLAALYQQFQ 3 PWD P P D L+ ACQSQPMTMD+YSR+AALYQQ+Q Sbjct: 427 PWDSRNPGDCLPPADPLSAFLACQSQPMTMDAYSRMAALYQQYQ 470