BLASTX nr result
ID: Mentha22_contig00009170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00009170 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU80425.1| 40S ribosomal protein S18 [Blumeria graminis f. ... 74 2e-11 gb|EPQ62680.1| Protein component of the small (40S) ribosomal su... 74 2e-11 gb|EPE27635.1| S13-like H2TH [Glarea lozoyensis ATCC 20868] 74 2e-11 gb|ELR03350.1| 40S ribosomal protein S18 [Pseudogymnoascus destr... 74 2e-11 ref|XP_007289121.1| 40S ribosomal protein S18 [Marssonina brunne... 74 2e-11 gb|EHL01912.1| putative 40S ribosomal protein S18 [Glarea lozoye... 74 2e-11 ref|XP_007594167.1| 40S ribosomal protein S18 [Colletotrichum fi... 73 5e-11 ref|XP_001229652.1| 40S ribosomal protein S18 [Chaetomium globos... 73 5e-11 ref|XP_387069.1| hypothetical protein FG06893.1 [Fusarium gramin... 73 5e-11 gb|ETS80506.1| 40S ribosomal protein S18 [Pestalotiopsis fici W1... 73 5e-11 gb|ERT01490.1| 40S ribosomal protein S18 [Sporothrix schenckii A... 73 5e-11 gb|EPS45455.1| hypothetical protein H072_613 [Dactylellina hapto... 73 5e-11 gb|EPE07338.1| 40s ribosomal protein s18 [Ophiostoma piceae UAMH... 73 5e-11 gb|EON98077.1| putative 40s ribosomal protein s18 protein [Togni... 73 5e-11 gb|ENH81144.1| 40s ribosomal protein s18 [Colletotrichum orbicul... 73 5e-11 gb|EMR67083.1| putative 40s ribosomal protein s18 protein [Eutyp... 73 5e-11 ref|XP_007273012.1| 40s ribosomal protein s18 [Colletotrichum gl... 73 5e-11 ref|XP_003710559.1| 40S ribosomal protein S18 [Magnaporthe oryza... 73 5e-11 emb|CCE33710.1| probable RPS18A-ribosomal protein S18.e.c4 [Clav... 73 5e-11 gb|EJT81374.1| 40S ribosomal protein S18 [Gaeumannomyces gramini... 73 5e-11 >emb|CCU80425.1| 40S ribosomal protein S18 [Blumeria graminis f. sp. hordei DH14] Length = 151 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG Sbjct: 119 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 151 >gb|EPQ62680.1| Protein component of the small (40S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 128 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG Sbjct: 96 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 128 >gb|EPE27635.1| S13-like H2TH [Glarea lozoyensis ATCC 20868] Length = 156 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 156 >gb|ELR03350.1| 40S ribosomal protein S18 [Pseudogymnoascus destructans 20631-21] Length = 156 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 156 >ref|XP_007289121.1| 40S ribosomal protein S18 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867512|gb|EKD20550.1| 40S ribosomal protein S18 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 123 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG Sbjct: 91 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 123 >gb|EHL01912.1| putative 40S ribosomal protein S18 [Glarea lozoyensis 74030] Length = 151 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG Sbjct: 119 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 151 >ref|XP_007594167.1| 40S ribosomal protein S18 [Colletotrichum fioriniae PJ7] gi|588901838|gb|EXF82264.1| 40S ribosomal protein S18 [Colletotrichum fioriniae PJ7] Length = 189 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 157 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 189 >ref|XP_001229652.1| 40S ribosomal protein S18 [Chaetomium globosum CBS 148.51] gi|88183733|gb|EAQ91201.1| hypothetical protein CHGG_03136 [Chaetomium globosum CBS 148.51] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >ref|XP_387069.1| hypothetical protein FG06893.1 [Fusarium graminearum PH-1] Length = 179 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 147 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 179 >gb|ETS80506.1| 40S ribosomal protein S18 [Pestalotiopsis fici W106-1] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >gb|ERT01490.1| 40S ribosomal protein S18 [Sporothrix schenckii ATCC 58251] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >gb|EPS45455.1| hypothetical protein H072_613 [Dactylellina haptotyla CBS 200.50] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >gb|EPE07338.1| 40s ribosomal protein s18 [Ophiostoma piceae UAMH 11346] Length = 128 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 96 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 128 >gb|EON98077.1| putative 40s ribosomal protein s18 protein [Togninia minima UCRPA7] Length = 151 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 119 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 151 >gb|ENH81144.1| 40s ribosomal protein s18 [Colletotrichum orbiculare MAFF 240422] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >gb|EMR67083.1| putative 40s ribosomal protein s18 protein [Eutypa lata UCREL1] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >ref|XP_007273012.1| 40s ribosomal protein s18 [Colletotrichum gloeosporioides Nara gc5] gi|429863445|gb|ELA37896.1| 40s ribosomal protein s18 [Colletotrichum gloeosporioides Nara gc5] gi|530477483|gb|EQB57026.1| hypothetical protein CGLO_02900 [Colletotrichum gloeosporioides Cg-14] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >ref|XP_003710559.1| 40S ribosomal protein S18 [Magnaporthe oryzae 70-15] gi|59802871|gb|AAX07649.1| 40S ribosomal protein S18-like protein [Magnaporthe grisea] gi|351650088|gb|EHA57947.1| 40S ribosomal protein S18 [Magnaporthe oryzae 70-15] gi|440467724|gb|ELQ36923.1| 40S ribosomal protein S18 [Magnaporthe oryzae Y34] gi|440480610|gb|ELQ61265.1| 40S ribosomal protein S18 [Magnaporthe oryzae P131] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >emb|CCE33710.1| probable RPS18A-ribosomal protein S18.e.c4 [Claviceps purpurea 20.1] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156 >gb|EJT81374.1| 40S ribosomal protein S18 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 371 GLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKGG 273 GLRHYWGLRVRGQH+KTTGRRGRTVGVSKKKGG Sbjct: 124 GLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG 156