BLASTX nr result
ID: Mentha22_contig00009021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00009021 (567 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35354.1| hypothetical protein MIMGU_mgv1a001641mg [Mimulus... 63 5e-08 ref|XP_004287143.1| PREDICTED: eukaryotic translation initiation... 60 5e-07 gb|EPS69198.1| hypothetical protein M569_05568, partial [Genlise... 57 3e-06 ref|XP_003610290.1| Eukaryotic initiation factor iso-4F subunit ... 56 7e-06 >gb|EYU35354.1| hypothetical protein MIMGU_mgv1a001641mg [Mimulus guttatus] Length = 780 Score = 63.2 bits (152), Expect = 5e-08 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -2 Query: 563 VGDDYYK-AIFNAAVKIVGSSPSGKELLDSQASDVTACESLF 441 V D YYK AIF+ AVKI+GS P+GKELLDSQAS+V ACESLF Sbjct: 739 VEDGYYKKAIFSGAVKIIGSDPAGKELLDSQASEVAACESLF 780 >ref|XP_004287143.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like [Fragaria vesca subsp. vesca] Length = 774 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/43 (67%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -2 Query: 566 KVGDDYY-KAIFNAAVKIVGSSPSGKELLDSQASDVTACESLF 441 +V DDYY KAIFNA ++I+ SSPSG+ +LDSQASD+ AC SLF Sbjct: 732 EVDDDYYQKAIFNAGLQIIDSSPSGQAVLDSQASDIEACRSLF 774 >gb|EPS69198.1| hypothetical protein M569_05568, partial [Genlisea aurea] Length = 763 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/39 (71%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -2 Query: 563 VGDDYY-KAIFNAAVKIVGSSPSGKELLDSQASDVTACE 450 VGDDYY KA+F +AV+IV S PSGK++L+SQASDV ACE Sbjct: 721 VGDDYYQKAVFTSAVEIVRSDPSGKKILESQASDVGACE 759 >ref|XP_003610290.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Medicago truncatula] gi|355511345|gb|AES92487.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Medicago truncatula] Length = 779 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -2 Query: 566 KVGDDYY-KAIFNAAVKIVGSSPSGKELLDSQASDVTACESLF 441 KVGDDY+ KAIFN+AV+++ SS SG+ +LDSQASD+ AC++LF Sbjct: 737 KVGDDYFQKAIFNSAVQVI-SSASGQAVLDSQASDIEACQALF 778