BLASTX nr result
ID: Mentha22_contig00008893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008893 (579 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 63 5e-08 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 62 8e-08 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 62 8e-08 ref|XP_007131799.1| hypothetical protein PHAVU_011G042700g [Phas... 61 2e-07 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 61 2e-07 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 60 3e-07 ref|NP_001119115.1| conserved peptide upstream open reading fram... 57 3e-06 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 56 6e-06 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 63.2 bits (152), Expect = 5e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 270 CMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 CMINSTYRRRTHLVQSFSVVFLYW YY+S Sbjct: 13 CMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 G MINSTYRRRTHLVQSFSVVFLYWFY+IS Sbjct: 12 GFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 GCMINST RRRTHLVQSFSVVFLYW YY+S Sbjct: 12 GCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_007131799.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] gi|561004799|gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 GCMINST RRRTHLVQSFSV FLYW YY+S Sbjct: 12 GCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|593267553|ref|XP_007135954.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 GCMINST RRRTHLVQSFSV FLYW YY+S Sbjct: 12 GCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 G MINSTYRRRTHLVQSFSVVFLYWFY IS Sbjct: 12 GFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 G M+NST RRRTHLVQSFSVVFLYW YY+S Sbjct: 13 GFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +3 Query: 267 GCMINSTYRRRTHLVQSFSVVFLYWFYYIS 356 G MINST RRRTHLVQSFSVVFLYWFY S Sbjct: 10 GFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39