BLASTX nr result
ID: Mentha22_contig00008602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008602 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004249708.1| PREDICTED: regulatory-associated protein of ... 66 4e-09 gb|EYU41987.1| hypothetical protein MIMGU_mgv1a000241mg [Mimulus... 66 6e-09 ref|XP_006366877.1| PREDICTED: regulatory-associated protein of ... 63 5e-08 ref|XP_004246316.1| PREDICTED: regulatory-associated protein of ... 63 5e-08 ref|XP_007033600.1| HEAT repeat,WD domain, G-beta repeat protein... 57 2e-06 ref|XP_004149929.1| PREDICTED: regulatory-associated protein of ... 57 3e-06 >ref|XP_004249708.1| PREDICTED: regulatory-associated protein of TOR 1-like [Solanum lycopersicum] Length = 1192 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 CLTFHPYQVLLAAGAADACVSIYADEISPP 275 CLTFHPYQVLLAAGAADACVSIYADEISPP Sbjct: 1162 CLTFHPYQVLLAAGAADACVSIYADEISPP 1191 >gb|EYU41987.1| hypothetical protein MIMGU_mgv1a000241mg [Mimulus guttatus] Length = 1375 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 364 CLTFHPYQVLLAAGAADACVSIYADEISPPR 272 CLTFHPYQVLLAAGAADACVSIYADEI PPR Sbjct: 1345 CLTFHPYQVLLAAGAADACVSIYADEILPPR 1375 >ref|XP_006366877.1| PREDICTED: regulatory-associated protein of TOR 1-like [Solanum tuberosum] Length = 1353 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 364 CLTFHPYQVLLAAGAADACVSIYADEISPPR 272 CLTFHPYQVLLAAGAAD+CVSIYADEI+P R Sbjct: 1323 CLTFHPYQVLLAAGAADSCVSIYADEIAPTR 1353 >ref|XP_004246316.1| PREDICTED: regulatory-associated protein of TOR 1-like [Solanum lycopersicum] Length = 1353 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 364 CLTFHPYQVLLAAGAADACVSIYADEISPPR 272 CLTFHPYQVLLAAGAAD+CVSIYADEI+P R Sbjct: 1323 CLTFHPYQVLLAAGAADSCVSIYADEITPTR 1353 >ref|XP_007033600.1| HEAT repeat,WD domain, G-beta repeat protein isoform 2 [Theobroma cacao] gi|508712629|gb|EOY04526.1| HEAT repeat,WD domain, G-beta repeat protein isoform 2 [Theobroma cacao] Length = 1362 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 364 CLTFHPYQVLLAAGAADACVSIYADEISPPR 272 CLTFHPYQV LAAGA DACVSIYAD+ S PR Sbjct: 1332 CLTFHPYQVRLAAGATDACVSIYADDNSQPR 1362 >ref|XP_004149929.1| PREDICTED: regulatory-associated protein of TOR 1-like [Cucumis sativus] gi|449517611|ref|XP_004165839.1| PREDICTED: regulatory-associated protein of TOR 1-like [Cucumis sativus] Length = 1362 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 364 CLTFHPYQVLLAAGAADACVSIYADEISPPR 272 CLTFHPY+VLLAAGAADACVSIYAD+ S R Sbjct: 1332 CLTFHPYEVLLAAGAADACVSIYADDNSQGR 1362