BLASTX nr result
ID: Mentha22_contig00008571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008571 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC51104.1| 40S ribosomal protein S16 [Morus notabilis] 89 6e-16 sp|P16149.1|RS16_LUPPO RecName: Full=40S ribosomal protein S16 g... 89 6e-16 ref|XP_007160464.1| hypothetical protein PHAVU_002G324300g [Phas... 89 6e-16 ref|XP_007153584.1| hypothetical protein PHAVU_003G047800g [Phas... 89 6e-16 ref|XP_006422982.1| hypothetical protein CICLE_v10029508mg [Citr... 89 6e-16 ref|XP_006419873.1| hypothetical protein CICLE_v10006162mg [Citr... 89 6e-16 ref|XP_006408213.1| hypothetical protein EUTSA_v10021712mg [Eutr... 89 6e-16 ref|XP_006400383.1| hypothetical protein EUTSA_v10014948mg [Eutr... 89 6e-16 gb|EPS69719.1| hypothetical protein M569_05046, partial [Genlise... 89 6e-16 gb|EPS67947.1| hypothetical protein M569_06824 [Genlisea aurea] 89 6e-16 gb|EPS63821.1| hypothetical protein M569_10962, partial [Genlise... 89 6e-16 ref|XP_007034683.1| Ribosomal protein S5 domain 2-like superfami... 89 6e-16 ref|XP_007042464.1| Ribosomal protein S5 domain 2-like superfami... 89 6e-16 ref|XP_004517192.1| PREDICTED: 40S ribosomal protein S16-like, p... 89 6e-16 ref|XP_004505244.1| PREDICTED: 40S ribosomal protein S16-like [C... 89 6e-16 ref|XP_004505243.1| PREDICTED: 40S ribosomal protein S16-like [C... 89 6e-16 ref|XP_004503325.1| PREDICTED: 40S ribosomal protein S16-like [C... 89 6e-16 ref|XP_004489248.1| PREDICTED: 40S ribosomal protein S16-like is... 89 6e-16 ref|XP_004489247.1| PREDICTED: 40S ribosomal protein S16-like is... 89 6e-16 ref|XP_004296911.1| PREDICTED: 40S ribosomal protein S16-like [F... 89 6e-16 >gb|EXC51104.1| 40S ribosomal protein S16 [Morus notabilis] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 104 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 145 >sp|P16149.1|RS16_LUPPO RecName: Full=40S ribosomal protein S16 gi|19512|emb|CAA36068.1| unnamed protein product [Lupinus polyphyllus] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 104 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 145 >ref|XP_007160464.1| hypothetical protein PHAVU_002G324300g [Phaseolus vulgaris] gi|561033879|gb|ESW32458.1| hypothetical protein PHAVU_002G324300g [Phaseolus vulgaris] Length = 147 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 106 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 147 >ref|XP_007153584.1| hypothetical protein PHAVU_003G047800g [Phaseolus vulgaris] gi|561026938|gb|ESW25578.1| hypothetical protein PHAVU_003G047800g [Phaseolus vulgaris] Length = 146 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 105 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 146 >ref|XP_006422982.1| hypothetical protein CICLE_v10029508mg [Citrus clementina] gi|568867433|ref|XP_006487042.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis] gi|568867437|ref|XP_006487044.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis] gi|557524916|gb|ESR36222.1| hypothetical protein CICLE_v10029508mg [Citrus clementina] Length = 148 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 107 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 148 >ref|XP_006419873.1| hypothetical protein CICLE_v10006162mg [Citrus clementina] gi|568872361|ref|XP_006489340.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis] gi|557521746|gb|ESR33113.1| hypothetical protein CICLE_v10006162mg [Citrus clementina] Length = 147 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 106 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 147 >ref|XP_006408213.1| hypothetical protein EUTSA_v10021712mg [Eutrema salsugineum] gi|557109359|gb|ESQ49666.1| hypothetical protein EUTSA_v10021712mg [Eutrema salsugineum] Length = 146 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 105 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 146 >ref|XP_006400383.1| hypothetical protein EUTSA_v10014948mg [Eutrema salsugineum] gi|557101473|gb|ESQ41836.1| hypothetical protein EUTSA_v10014948mg [Eutrema salsugineum] Length = 146 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 105 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 146 >gb|EPS69719.1| hypothetical protein M569_05046, partial [Genlisea aurea] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 104 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 145 >gb|EPS67947.1| hypothetical protein M569_06824 [Genlisea aurea] Length = 144 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 103 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 144 >gb|EPS63821.1| hypothetical protein M569_10962, partial [Genlisea aurea] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 104 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 145 >ref|XP_007034683.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma cacao] gi|508713712|gb|EOY05609.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma cacao] Length = 144 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 103 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 144 >ref|XP_007042464.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma cacao] gi|508706399|gb|EOX98295.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma cacao] Length = 146 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 105 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 146 >ref|XP_004517192.1| PREDICTED: 40S ribosomal protein S16-like, partial [Cicer arietinum] Length = 84 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 43 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 84 >ref|XP_004505244.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum] Length = 143 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 102 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 143 >ref|XP_004505243.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum] Length = 99 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 58 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 99 >ref|XP_004503325.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum] gi|502138213|ref|XP_004503326.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum] Length = 140 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 99 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 140 >ref|XP_004489248.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Cicer arietinum] gi|502090501|ref|XP_004489249.1| PREDICTED: 40S ribosomal protein S16-like isoform X3 [Cicer arietinum] Length = 140 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 99 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 140 >ref|XP_004489247.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Cicer arietinum] Length = 181 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 140 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 181 >ref|XP_004296911.1| PREDICTED: 40S ribosomal protein S16-like [Fragaria vesca subsp. vesca] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 482 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 357 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Sbjct: 104 KKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 145