BLASTX nr result
ID: Mentha22_contig00008327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008327 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21543.1| hypothetical protein MIMGU_mgv1a013195mg [Mimulus... 75 1e-11 gb|EYU24694.1| hypothetical protein MIMGU_mgv1a013752mg [Mimulus... 71 1e-10 gb|EPS63390.1| hypothetical protein M569_11397, partial [Genlise... 68 1e-09 gb|EPS74475.1| hypothetical protein M569_00286, partial [Genlise... 62 1e-07 ref|XP_007024135.1| Late embryogenesis abundant hydroxyproline-r... 61 2e-07 ref|XP_007024134.1| Late embryogenesis abundant hydroxyproline-r... 61 2e-07 ref|XP_007024133.1| Late embryogenesis abundant hydroxyproline-r... 61 2e-07 ref|XP_004235710.1| PREDICTED: uncharacterized protein LOC101250... 60 2e-07 ref|XP_006341680.1| PREDICTED: uncharacterized protein LOC102589... 60 4e-07 ref|XP_002279706.1| PREDICTED: uncharacterized protein LOC100258... 60 4e-07 emb|CAN72107.1| hypothetical protein VITISV_044045 [Vitis vinifera] 60 4e-07 ref|XP_002516077.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_007216392.1| hypothetical protein PRUPE_ppa021471mg [Prun... 59 9e-07 ref|XP_002284574.1| PREDICTED: uncharacterized protein LOC100254... 58 1e-06 emb|CBI28084.3| unnamed protein product [Vitis vinifera] 58 1e-06 ref|XP_002304190.2| hypothetical protein POPTR_0003s05380g, part... 56 5e-06 ref|XP_007024140.1| Late embryogenesis abundant hydroxyproline-r... 56 6e-06 ref|XP_007024139.1| Late embryogenesis abundant hydroxyproline-r... 56 6e-06 ref|XP_007024137.1| Late embryogenesis abundant hydroxyproline-r... 56 6e-06 >gb|EYU21543.1| hypothetical protein MIMGU_mgv1a013195mg [Mimulus guttatus] Length = 228 Score = 74.7 bits (182), Expect = 1e-11 Identities = 29/47 (61%), Positives = 41/47 (87%) Frame = +2 Query: 173 GYLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 GYLLWP+ P+LS++ LR+DRLQFHT PK+S+D T++LT+ +RN+D Y Sbjct: 67 GYLLWPAKPQLSIIRLRLDRLQFHTIPKMSVDVTMDLTVKVRNEDFY 113 >gb|EYU24694.1| hypothetical protein MIMGU_mgv1a013752mg [Mimulus guttatus] Length = 211 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/73 (47%), Positives = 44/73 (60%) Frame = +2 Query: 95 RHRLLRSXXXXXXXXXXXXXXXXXXXGYLLWPSDPELSVVHLRIDRLQFHTSPKISLDAT 274 R RLLR YL+WPSDPELSVV + ++RL FHT PKISLD T Sbjct: 29 RQRLLRKLHRRRLICFSAVFLFLISAVYLVWPSDPELSVVRMSLNRLHFHTRPKISLDVT 88 Query: 275 LNLTIMIRNQDMY 313 L+L + +RN+D+Y Sbjct: 89 LDLRLKVRNRDVY 101 >gb|EPS63390.1| hypothetical protein M569_11397, partial [Genlisea aurea] Length = 201 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPSDPEL + L++DRL FHT P ISLD TL+LTI +RN+D Y Sbjct: 46 YVFWPSDPELLISDLKLDRLGFHTKPVISLDVTLDLTIQVRNRDFY 91 >gb|EPS74475.1| hypothetical protein M569_00286, partial [Genlisea aurea] Length = 211 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/73 (41%), Positives = 38/73 (52%) Frame = +2 Query: 95 RHRLLRSXXXXXXXXXXXXXXXXXXXGYLLWPSDPELSVVHLRIDRLQFHTSPKISLDAT 274 RHRLL YL WP DP +SVV L +DRL+FH PK S+D T Sbjct: 28 RHRLLTRRGRRCLVGCATTLLFLAAAAYLFWPYDPSISVVRLHLDRLRFHRLPKFSVDLT 87 Query: 275 LNLTIMIRNQDMY 313 L++T+ + N D Y Sbjct: 88 LDVTLRVWNGDFY 100 >ref|XP_007024135.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 3 [Theobroma cacao] gi|508779501|gb|EOY26757.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 3 [Theobroma cacao] Length = 222 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPSDPE+ +V + +DR+Q HT P I+LD +L +T+ +RN D+Y Sbjct: 65 YIFWPSDPEVKIVRMHVDRMQLHTIPIIALDISLLVTLKVRNSDVY 110 >ref|XP_007024134.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 2 [Theobroma cacao] gi|508779500|gb|EOY26756.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 2 [Theobroma cacao] Length = 249 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPSDPE+ +V + +DR+Q HT P I+LD +L +T+ +RN D+Y Sbjct: 65 YIFWPSDPEVKIVRMHVDRMQLHTIPIIALDISLLVTLKVRNSDVY 110 >ref|XP_007024133.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 1 [Theobroma cacao] gi|508779499|gb|EOY26755.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 1 [Theobroma cacao] Length = 220 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPSDPE+ +V + +DR+Q HT P I+LD +L +T+ +RN D+Y Sbjct: 65 YIFWPSDPEVKIVRMHVDRMQLHTIPIIALDISLLVTLKVRNSDVY 110 >ref|XP_004235710.1| PREDICTED: uncharacterized protein LOC101250488 [Solanum lycopersicum] Length = 221 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 +L+WPSDPELS+ L++ L+ H+ PKI++D TL++T IRN+D Y Sbjct: 67 FLIWPSDPELSIARLKLRHLKVHSFPKIAIDVTLDVTAKIRNKDFY 112 >ref|XP_006341680.1| PREDICTED: uncharacterized protein LOC102589613 [Solanum tuberosum] Length = 221 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 + LWPSDPELS+ L++ L+ H+ PKI++D TL++T IRN+D Y Sbjct: 67 FFLWPSDPELSIARLKLRHLKVHSFPKIAIDVTLDVTAKIRNKDFY 112 >ref|XP_002279706.1| PREDICTED: uncharacterized protein LOC100258307 [Vitis vinifera] Length = 237 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/46 (47%), Positives = 37/46 (80%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 ++LWPSDP++S+V LR+ R+ HT P++SLD +++L + +RN D+Y Sbjct: 83 FVLWPSDPDVSIVRLRLRRIAVHTFPRLSLDVSMSLMVKVRNVDLY 128 >emb|CAN72107.1| hypothetical protein VITISV_044045 [Vitis vinifera] Length = 224 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/46 (47%), Positives = 37/46 (80%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 ++LWPSDP++S+V LR+ R+ HT P++SLD +++L + +RN D+Y Sbjct: 77 FVLWPSDPDVSIVRLRLRRIAVHTFPRLSLDVSMSLMVKVRNVDLY 122 >ref|XP_002516077.1| conserved hypothetical protein [Ricinus communis] gi|223544982|gb|EEF46497.1| conserved hypothetical protein [Ricinus communis] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 YL WPSDP L +V LR+++L HT P I++D +L++T+ +RN D+Y Sbjct: 65 YLFWPSDPTLKIVRLRLNKLHIHTLPIINIDVSLHVTVKVRNVDVY 110 >ref|XP_007216392.1| hypothetical protein PRUPE_ppa021471mg [Prunus persica] gi|462412542|gb|EMJ17591.1| hypothetical protein PRUPE_ppa021471mg [Prunus persica] Length = 232 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/46 (47%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 +L WPSDP L +V LR++R+Q HT P +++D ++ +TI +RN D+Y Sbjct: 60 FLFWPSDPSLKIVRLRLNRVQVHTRPHVAIDVSMLVTIKVRNGDVY 105 >ref|XP_002284574.1| PREDICTED: uncharacterized protein LOC100254347 [Vitis vinifera] Length = 212 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 YLL+PSDP + VV L ++ +Q HTSP ISLD +L+LTI +RN+D + Sbjct: 58 YLLYPSDPTVQVVGLHLNSVQVHTSPVISLDLSLDLTIRVRNRDFF 103 >emb|CBI28084.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 YLL+PSDP + VV L ++ +Q HTSP ISLD +L+LTI +RN+D + Sbjct: 58 YLLYPSDPTVQVVGLHLNSVQVHTSPVISLDLSLDLTIRVRNRDFF 103 >ref|XP_002304190.2| hypothetical protein POPTR_0003s05380g, partial [Populus trichocarpa] gi|550342460|gb|EEE79169.2| hypothetical protein POPTR_0003s05380g, partial [Populus trichocarpa] Length = 171 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/46 (47%), Positives = 35/46 (76%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPSDP + VV LR+D+++ HT P I++D +L +T+ +RN D+Y Sbjct: 17 YVFWPSDPMIKVVGLRLDKIRIHTLPIINIDLSLYVTLRVRNVDVY 62 >ref|XP_007024140.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 4 [Theobroma cacao] gi|508779506|gb|EOY26762.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 4 [Theobroma cacao] Length = 167 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPS PE+ +V + + R+Q HT P I+LD +L +T+ +RN D+Y Sbjct: 12 YIFWPSQPEVKIVRMHVKRMQMHTVPIIALDISLLVTLKVRNSDVY 57 >ref|XP_007024139.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 3 [Theobroma cacao] gi|508779505|gb|EOY26761.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 3 [Theobroma cacao] Length = 158 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPS PE+ +V + + R+Q HT P I+LD +L +T+ +RN D+Y Sbjct: 12 YIFWPSQPEVKIVRMHVKRMQMHTVPIIALDISLLVTLKVRNSDVY 57 >ref|XP_007024137.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 1 [Theobroma cacao] gi|590618778|ref|XP_007024138.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 1 [Theobroma cacao] gi|508779503|gb|EOY26759.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 1 [Theobroma cacao] gi|508779504|gb|EOY26760.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein isoform 1 [Theobroma cacao] Length = 165 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +2 Query: 176 YLLWPSDPELSVVHLRIDRLQFHTSPKISLDATLNLTIMIRNQDMY 313 Y+ WPS PE+ +V + + R+Q HT P I+LD +L +T+ +RN D+Y Sbjct: 12 YIFWPSQPEVKIVRMHVKRMQMHTVPIIALDISLLVTLKVRNSDVY 57