BLASTX nr result
ID: Mentha22_contig00007922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00007922 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28426.1| hypothetical protein MIMGU_mgv1a000186mg [Mimulus... 70 2e-10 >gb|EYU28426.1| hypothetical protein MIMGU_mgv1a000186mg [Mimulus guttatus] gi|604315862|gb|EYU28427.1| hypothetical protein MIMGU_mgv1a000186mg [Mimulus guttatus] Length = 1469 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +2 Query: 194 GNTFLQPQANSLTHRAPISTEFLGRRITLQKNKLQMGKLCTI--LRSTKAVLAADPSS 361 GNTF Q QA SLT ++ ISTEFLG R+ ++++KL+MGK C+ RST+AVLAADPSS Sbjct: 34 GNTFFQAQATSLTQKSSISTEFLGNRLKVRRHKLKMGKCCSSSRSRSTRAVLAADPSS 91