BLASTX nr result
ID: Mentha22_contig00007845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00007845 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45365.1| hypothetical protein MIMGU_mgv1a011735mg [Mimulus... 69 9e-10 >gb|EYU45365.1| hypothetical protein MIMGU_mgv1a011735mg [Mimulus guttatus] Length = 272 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/52 (67%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -1 Query: 154 PQFQKSSFQGVSVQEAKRAVFNSLVLEG-ISTSSVRSVRKRGLEVNARTGTA 2 PQFQK+SFQG+S+Q+AKR VFNSLV E I S+V+SVR+RG E+ AR GTA Sbjct: 33 PQFQKTSFQGLSIQDAKRVVFNSLVSERIIINSNVKSVRERGFEITARAGTA 84