BLASTX nr result
ID: Mentha22_contig00007599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00007599 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25732.1| hypothetical protein MIMGU_mgv1a002266mg [Mimulus... 60 4e-07 >gb|EYU25732.1| hypothetical protein MIMGU_mgv1a002266mg [Mimulus guttatus] Length = 693 Score = 59.7 bits (143), Expect = 4e-07 Identities = 41/90 (45%), Positives = 51/90 (56%) Frame = -2 Query: 400 NEDIVNLRSSIAVKEKQGSSQKEAEKQPCPPSEERKESDSRTEAEAVGMKVDSHVSDASK 221 N+DIVN S I V+ K KE EERKE D+ + A + D D+SK Sbjct: 616 NDDIVNFGSRI-VEGKAVEHLKE--------DEERKEPDNTSGAVSAKENCD----DSSK 662 Query: 220 KRKIDHSSFLAALFGMDEEKLNKILLSEPP 131 +RK + S LA L GMDE +LNK+LLSEPP Sbjct: 663 RRKTEQCSLLALLMGMDEVELNKLLLSEPP 692