BLASTX nr result
ID: Mentha22_contig00006261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006261 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45194.1| hypothetical protein MIMGU_mgv1a013344mg [Mimulus... 70 2e-10 >gb|EYU45194.1| hypothetical protein MIMGU_mgv1a013344mg [Mimulus guttatus] Length = 223 Score = 70.5 bits (171), Expect = 2e-10 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +2 Query: 2 PTVLFCLMNVMIGTIFFRSSLKPPRTKQQNKDELEXXXXXXXPR-FERVSSFLERVKSFN 178 PTVLFCL+N+MIGTIF RS + PR QN E PR RV F ERVKSFN Sbjct: 15 PTVLFCLLNLMIGTIFMRSKIVKPRRNPQNSGE---DNNDEQPRQLGRVPGFFERVKSFN 71 Query: 179 LSRYEAEHQPDPVH 220 LSRY+ + QP P H Sbjct: 72 LSRYQFD-QPGPDH 84