BLASTX nr result
ID: Mentha22_contig00006113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006113 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515007.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_004515007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 2 HMKKTTADLVMSGVRFFGLERRLKAKGCSFLPS 100 HMKK TADLV+SG++FFGLE +LK+KGC LPS Sbjct: 688 HMKKKTADLVISGLKFFGLESKLKSKGCKLLPS 720