BLASTX nr result
ID: Mentha22_contig00004989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004989 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18252.1| hypothetical protein MIMGU_mgv1a0153742mg, partia... 58 2e-06 >gb|EYU18252.1| hypothetical protein MIMGU_mgv1a0153742mg, partial [Mimulus guttatus] Length = 97 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 308 FILNSTAPQYFICTIGDHCSRGQKVTVEVRDFSAATP 198 FILNST P YFICT+ +HC GQKVT+++R F +A P Sbjct: 39 FILNSTTPHYFICTVENHCRLGQKVTIQIRQFPSAAP 75