BLASTX nr result
ID: Mentha22_contig00004682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004682 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS57799.1| hypothetical protein M569_17018, partial [Genlise... 64 2e-08 ref|XP_004300309.1| PREDICTED: casein kinase II subunit beta-lik... 63 5e-08 ref|XP_004300307.1| PREDICTED: casein kinase II subunit beta-lik... 63 5e-08 ref|XP_006445463.1| hypothetical protein CICLE_v10021491mg [Citr... 61 1e-07 ref|XP_006445462.1| hypothetical protein CICLE_v10021491mg [Citr... 61 1e-07 ref|XP_007052392.1| Casein kinase II beta subunit 4 isoform 1 [T... 61 1e-07 ref|XP_007220529.1| hypothetical protein PRUPE_ppa009433mg [Prun... 61 1e-07 gb|AEK26563.1| casein kinase II beta subunit [Populus tremula] g... 61 1e-07 gb|AEK05627.1| casein kinase II beta subunit [Populus balsamifer... 61 1e-07 ref|XP_002301241.1| Casein kinase II beta-3 subunit family prote... 61 1e-07 ref|NP_191584.1| casein kinase 2 subunit beta-3 [Arabidopsis tha... 61 2e-07 ref|XP_003631466.1| PREDICTED: casein kinase II subunit beta-lik... 61 2e-07 ref|XP_003631465.1| PREDICTED: casein kinase II subunit beta-lik... 61 2e-07 ref|XP_002279768.2| PREDICTED: casein kinase II subunit beta-lik... 61 2e-07 emb|CBI33984.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|NP_001118861.1| casein kinase 2 subunit beta-3 [Arabidopsis ... 61 2e-07 gb|EYU42329.1| hypothetical protein MIMGU_mgv1a011373mg [Mimulus... 60 3e-07 gb|EYU40338.1| hypothetical protein MIMGU_mgv1a011391mg [Mimulus... 60 3e-07 ref|XP_007156603.1| hypothetical protein PHAVU_002G002500g [Phas... 60 4e-07 ref|XP_007156602.1| hypothetical protein PHAVU_002G002500g [Phas... 60 4e-07 >gb|EPS57799.1| hypothetical protein M569_17018, partial [Genlisea aurea] Length = 226 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQKPTQSY+P VFGFK+HKP Sbjct: 197 LFLMTYGHLKPQKPTQSYIPKVFGFKLHKP 226 >ref|XP_004300309.1| PREDICTED: casein kinase II subunit beta-like isoform 4 [Fragaria vesca subsp. vesca] Length = 266 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQKP+QSYVP VFGFK+HKP Sbjct: 237 LFLMTYGHLKPQKPSQSYVPRVFGFKLHKP 266 >ref|XP_004300307.1| PREDICTED: casein kinase II subunit beta-like isoform 2 [Fragaria vesca subsp. vesca] Length = 289 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQKP+QSYVP VFGFK+HKP Sbjct: 260 LFLMTYGHLKPQKPSQSYVPRVFGFKLHKP 289 >ref|XP_006445463.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] gi|557547725|gb|ESR58703.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] Length = 235 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQSYVP VFGFK+HKP Sbjct: 206 LFLMTYGHLKPQKATQSYVPRVFGFKLHKP 235 >ref|XP_006445462.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] gi|568819717|ref|XP_006464392.1| PREDICTED: putative casein kinase II subunit beta-4-like [Citrus sinensis] gi|557547724|gb|ESR58702.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] Length = 288 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQSYVP VFGFK+HKP Sbjct: 259 LFLMTYGHLKPQKATQSYVPRVFGFKLHKP 288 >ref|XP_007052392.1| Casein kinase II beta subunit 4 isoform 1 [Theobroma cacao] gi|508704653|gb|EOX96549.1| Casein kinase II beta subunit 4 isoform 1 [Theobroma cacao] Length = 288 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLM+YGHLKPQKPTQ+Y P VFGFKMHKP Sbjct: 259 LFLMSYGHLKPQKPTQNYTPRVFGFKMHKP 288 >ref|XP_007220529.1| hypothetical protein PRUPE_ppa009433mg [Prunus persica] gi|462416991|gb|EMJ21728.1| hypothetical protein PRUPE_ppa009433mg [Prunus persica] Length = 292 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQSYVP VFGFK+HKP Sbjct: 263 LFLMTYGHLKPQKATQSYVPRVFGFKLHKP 292 >gb|AEK26563.1| casein kinase II beta subunit [Populus tremula] gi|340007717|gb|AEK26564.1| casein kinase II beta subunit [Populus tremula] gi|340007719|gb|AEK26565.1| casein kinase II beta subunit [Populus tremula] Length = 125 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQSYVP VFGFK+HKP Sbjct: 96 LFLMTYGHLKPQKATQSYVPRVFGFKLHKP 125 >gb|AEK05627.1| casein kinase II beta subunit [Populus balsamifera] gi|339777581|gb|AEK05628.1| casein kinase II beta subunit [Populus balsamifera] gi|339777583|gb|AEK05629.1| casein kinase II beta subunit [Populus balsamifera] gi|339777585|gb|AEK05630.1| casein kinase II beta subunit [Populus balsamifera] gi|339777587|gb|AEK05631.1| casein kinase II beta subunit [Populus balsamifera] gi|339777589|gb|AEK05632.1| casein kinase II beta subunit [Populus balsamifera] gi|339777591|gb|AEK05633.1| casein kinase II beta subunit [Populus balsamifera] gi|339777593|gb|AEK05634.1| casein kinase II beta subunit [Populus balsamifera] gi|339777595|gb|AEK05635.1| casein kinase II beta subunit [Populus balsamifera] gi|339777597|gb|AEK05636.1| casein kinase II beta subunit [Populus balsamifera] gi|339777599|gb|AEK05637.1| casein kinase II beta subunit [Populus balsamifera] gi|339777601|gb|AEK05638.1| casein kinase II beta subunit [Populus balsamifera] gi|339777603|gb|AEK05639.1| casein kinase II beta subunit [Populus balsamifera] gi|339777605|gb|AEK05640.1| casein kinase II beta subunit [Populus balsamifera] gi|339777607|gb|AEK05641.1| casein kinase II beta subunit [Populus balsamifera] gi|339777609|gb|AEK05642.1| casein kinase II beta subunit [Populus balsamifera] gi|339777611|gb|AEK05643.1| casein kinase II beta subunit [Populus balsamifera] Length = 301 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQSYVP VFGFK+HKP Sbjct: 272 LFLMTYGHLKPQKATQSYVPRVFGFKLHKP 301 >ref|XP_002301241.1| Casein kinase II beta-3 subunit family protein [Populus trichocarpa] gi|222842967|gb|EEE80514.1| Casein kinase II beta-3 subunit family protein [Populus trichocarpa] Length = 301 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQSYVP VFGFK+HKP Sbjct: 272 LFLMTYGHLKPQKATQSYVPRVFGFKLHKP 301 >ref|NP_191584.1| casein kinase 2 subunit beta-3 [Arabidopsis thaliana] gi|6016427|sp|O81275.1|CSK2D_ARATH RecName: Full=Casein kinase II subunit beta-3; Short=CK II beta-3 gi|3493611|gb|AAC33896.1| regulatory subunit of protein kinase CK2 [Arabidopsis thaliana] gi|7576201|emb|CAB87862.1| regulatory subunit of protein kinase CK2 [Arabidopsis thaliana] gi|90186246|gb|ABD91499.1| At3g60250 [Arabidopsis thaliana] gi|110738341|dbj|BAF01098.1| regulatory subunit of protein kinase CK2 [Arabidopsis thaliana] gi|332646509|gb|AEE80030.1| casein kinase 2 subunit beta-3 [Arabidopsis thaliana] Length = 276 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYG+LKPQKPTQSYVP +FGFK+HKP Sbjct: 247 LFLMTYGNLKPQKPTQSYVPKIFGFKVHKP 276 >ref|XP_003631466.1| PREDICTED: casein kinase II subunit beta-like isoform 3 [Vitis vinifera] Length = 282 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK +QSYVP VFGFKMHKP Sbjct: 253 LFLMTYGHLKPQKASQSYVPRVFGFKMHKP 282 >ref|XP_003631465.1| PREDICTED: casein kinase II subunit beta-like isoform 2 [Vitis vinifera] Length = 276 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK +QSYVP VFGFKMHKP Sbjct: 247 LFLMTYGHLKPQKASQSYVPRVFGFKMHKP 276 >ref|XP_002279768.2| PREDICTED: casein kinase II subunit beta-like isoform 1 [Vitis vinifera] Length = 285 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK +QSYVP VFGFKMHKP Sbjct: 256 LFLMTYGHLKPQKASQSYVPRVFGFKMHKP 285 >emb|CBI33984.3| unnamed protein product [Vitis vinifera] Length = 266 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK +QSYVP VFGFKMHKP Sbjct: 237 LFLMTYGHLKPQKASQSYVPRVFGFKMHKP 266 >ref|NP_001118861.1| casein kinase 2 subunit beta-3 [Arabidopsis thaliana] gi|332646510|gb|AEE80031.1| casein kinase 2 subunit beta-3 [Arabidopsis thaliana] Length = 275 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYG+LKPQKPTQSYVP +FGFK+HKP Sbjct: 246 LFLMTYGNLKPQKPTQSYVPKIFGFKVHKP 275 >gb|EYU42329.1| hypothetical protein MIMGU_mgv1a011373mg [Mimulus guttatus] Length = 283 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHK 89 LFLMTYGHLKPQKPTQ YVP VFGFK+HK Sbjct: 254 LFLMTYGHLKPQKPTQDYVPRVFGFKLHK 282 >gb|EYU40338.1| hypothetical protein MIMGU_mgv1a011391mg [Mimulus guttatus] Length = 283 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYGHLKPQK TQ+YVP VFGFK+HKP Sbjct: 254 LFLMTYGHLKPQKSTQNYVPRVFGFKLHKP 283 >ref|XP_007156603.1| hypothetical protein PHAVU_002G002500g [Phaseolus vulgaris] gi|561030018|gb|ESW28597.1| hypothetical protein PHAVU_002G002500g [Phaseolus vulgaris] Length = 284 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYG LKPQKP+QSYVP VFGFK+HKP Sbjct: 255 LFLMTYGQLKPQKPSQSYVPRVFGFKLHKP 284 >ref|XP_007156602.1| hypothetical protein PHAVU_002G002500g [Phaseolus vulgaris] gi|561030017|gb|ESW28596.1| hypothetical protein PHAVU_002G002500g [Phaseolus vulgaris] Length = 285 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LFLMTYGHLKPQKPTQSYVP*VFGFKMHKP 92 LFLMTYG LKPQKP+QSYVP VFGFK+HKP Sbjct: 256 LFLMTYGQLKPQKPSQSYVPRVFGFKLHKP 285