BLASTX nr result
ID: Mentha22_contig00004657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004657 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chlo... 80 2e-13 gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea] 80 4e-13 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata] 79 8e-13 ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplast... 78 1e-12 gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum] 78 1e-12 ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana] g... 78 1e-12 ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutr... 78 1e-12 ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Caps... 78 1e-12 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris] gi|17134... 78 1e-12 gb|AAN84539.1| putative plastidic glutamine synthetase, partial ... 78 1e-12 ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arab... 78 1e-12 dbj|BAD94507.1| glutamate-ammonia ligase precursor [Arabidopsis ... 78 1e-12 ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prun... 77 2e-12 gb|AAB61302.1| chloroplastic glutamine synthetase [Helianthus an... 77 2e-12 gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precu... 77 2e-12 gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegu... 77 3e-12 ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citr... 76 4e-12 ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme... 76 5e-12 ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme... 76 5e-12 gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans... 76 5e-12 >sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|2454633|gb|AAB71693.1| glutamine synthetase [Daucus carota] Length = 432 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQK+SLNV Sbjct: 393 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKLSLNV 432 >gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea] Length = 431 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQK+SLNV Sbjct: 392 RPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKLSLNV 431 >gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata] Length = 432 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQK++LNV Sbjct: 393 RPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKLALNV 432 >ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum] Length = 432 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQKISL V Sbjct: 393 RPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKISLKV 432 >gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum] Length = 432 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQKISL V Sbjct: 393 RPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKISLKV 432 >ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana] gi|79329037|ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana] gi|145334587|ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana] gi|11386828|sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|16226677|gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana] gi|16226744|gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana] gi|240070|gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana] gi|6681579|dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana] gi|9758688|dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast (clone lambdaAtgsl1) [Arabidopsis thaliana] gi|19698811|gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana] gi|20268721|gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis thaliana] gi|21593796|gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast [Arabidopsis thaliana] gi|21689899|gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis thaliana] gi|222423662|dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana] gi|332006610|gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana] gi|332006611|gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana] gi|332006612|gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana] gi|228453|prf||1804333A Gln synthetase Length = 430 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLNV Sbjct: 391 RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLNV 430 >ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|567143676|ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|567143680|ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|557092591|gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|557092592|gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|557092593|gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] Length = 426 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLNV Sbjct: 387 RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLNV 426 >ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella] gi|482551322|gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella] Length = 429 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLNV Sbjct: 390 RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLNV 429 >gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris] gi|171346264|gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris] Length = 431 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAE+TLLWEPTLEAEALAAQ++SLNV Sbjct: 392 RPASNMDPYVVTGLLAESTLLWEPTLEAEALAAQRLSLNV 431 >gb|AAN84539.1| putative plastidic glutamine synthetase, partial [Gazania splendens] Length = 224 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY VTGLLAETTLLWEPTLEAEALAAQK++LNV Sbjct: 185 RPASNMDPYTVTGLLAETTLLWEPTLEAEALAAQKLALNV 224 >ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. lyrata] gi|297314264|gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. lyrata] Length = 429 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLNV Sbjct: 390 RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLNV 429 >dbj|BAD94507.1| glutamate-ammonia ligase precursor [Arabidopsis thaliana] Length = 179 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLNV Sbjct: 140 RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLNV 179 >ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica] gi|462419320|gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica] Length = 432 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVT LLAETTLLWEPTLEAEALAAQK++LNV Sbjct: 393 RPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLALNV 432 >gb|AAB61302.1| chloroplastic glutamine synthetase [Helianthus annuus] Length = 174 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY VTGLLAETT+LWEPTLEAEALAAQK++LNV Sbjct: 135 RPASNMDPYTVTGLLAETTILWEPTLEAEALAAQKLALNV 174 >gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum crystallinum] Length = 433 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKI++ V Sbjct: 394 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKIAMKV 433 >gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli] Length = 432 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK++LNV Sbjct: 393 RPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLALNV 432 >ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina] gi|568872159|ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 [Citrus sinensis] gi|568872161|ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 [Citrus sinensis] gi|557521651|gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina] Length = 432 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVT LLAETT+LWEPTLEAEALAAQK++LNV Sbjct: 393 RPASNMDPYVVTSLLAETTILWEPTLEAEALAAQKLALNV 432 >ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, partial [Cucumis sativus] Length = 249 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVT LLAETTLLWEPTLEAEALAAQK+SL V Sbjct: 210 RPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLSLKV 249 >ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like [Cucumis sativus] Length = 432 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPYVVT LLAETTLLWEPTLEAEALAAQK+SL V Sbjct: 393 RPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLSLKV 432 >gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra] Length = 432 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 319 RPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLNV 200 RPASNMDPY+VT LLAETT+LWEPTLEAEALAAQK++LNV Sbjct: 393 RPASNMDPYIVTSLLAETTILWEPTLEAEALAAQKLALNV 432