BLASTX nr result
ID: Mentha22_contig00004530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004530 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34742.1| hypothetical protein MIMGU_mgv1a023651mg, partial... 49 5e-09 >gb|EYU34742.1| hypothetical protein MIMGU_mgv1a023651mg, partial [Mimulus guttatus] Length = 606 Score = 48.9 bits (115), Expect(2) = 5e-09 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 Query: 99 DAVSFSSMLHGCVCNGRMYESIGVLRDMMANDF 1 D V FS+MLHGCV NGR +SIGV RDM+A +F Sbjct: 349 DVVCFSAMLHGCVQNGRESQSIGVFRDMLARNF 381 Score = 37.4 bits (85), Expect(2) = 5e-09 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -2 Query: 187 DKCVNKALIDMYMSCSSPDEAF*AFERVSR 98 D V+ ALIDMYMSCS PDEA F+ + + Sbjct: 318 DILVSTALIDMYMSCSCPDEAIEVFDHMPK 347