BLASTX nr result
ID: Mentha22_contig00004387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004387 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27496.1| hypothetical protein MIMGU_mgv1a017725mg [Mimulus... 59 5e-07 >gb|EYU27496.1| hypothetical protein MIMGU_mgv1a017725mg [Mimulus guttatus] Length = 127 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 6 NLSVDPRRRWNPAGTSGYRSPGRGRFYQTRRWETDQCW 119 NL+V+ +RR++ T GYRSPGRGRF TRRWETDQCW Sbjct: 93 NLNVNSQRRFS---TGGYRSPGRGRFQSTRRWETDQCW 127