BLASTX nr result
ID: Mentha22_contig00004157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004157 (762 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18820.1| hypothetical protein MIMGU_mgv1a012187mg [Mimulus... 83 1e-13 >gb|EYU18820.1| hypothetical protein MIMGU_mgv1a012187mg [Mimulus guttatus] Length = 259 Score = 82.8 bits (203), Expect = 1e-13 Identities = 39/76 (51%), Positives = 59/76 (77%), Gaps = 3/76 (3%) Frame = +3 Query: 3 GQPIYDDYMDYKRFICEAYKGTPKPSAC-TETSMGRIRKVKMDLLDSLYGEK--SFKAKL 173 G+P+YDDY ++ +IC+AYKGT KPSAC +E+S+G+IRKVKM+L++SL+GE+ ++ Sbjct: 180 GEPLYDDYRNFVSYICKAYKGTAKPSACSSESSVGQIRKVKMNLINSLFGEETSNYSKLF 239 Query: 174 SRVLPAILSWLQ*SKI 221 V A+LSWL +K+ Sbjct: 240 QTVQQAVLSWLPGNKV 255