BLASTX nr result
ID: Mentha22_contig00004155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004155 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001759152.1| predicted protein [Physcomitrella patens] gi... 82 8e-14 ref|XP_001760999.1| predicted protein [Physcomitrella patens] gi... 82 8e-14 gb|EYU45496.1| hypothetical protein MIMGU_mgv1a003086mg [Mimulus... 82 1e-13 gb|EYU29663.1| hypothetical protein MIMGU_mgv1a003097mg [Mimulus... 82 1e-13 gb|EXC24961.1| ATP-citrate synthase beta chain protein 1 [Morus ... 82 1e-13 ref|XP_006488840.1| PREDICTED: ATP-citrate synthase beta chain p... 82 1e-13 ref|XP_006358207.1| PREDICTED: ATP-citrate synthase beta chain p... 82 1e-13 ref|XP_006349840.1| PREDICTED: ATP-citrate synthase beta chain p... 82 1e-13 ref|XP_007154379.1| hypothetical protein PHAVU_003G114300g, part... 82 1e-13 ref|XP_007147365.1| hypothetical protein PHAVU_006G118100g [Phas... 82 1e-13 ref|XP_006419381.1| hypothetical protein CICLE_v10004572mg [Citr... 82 1e-13 ref|XP_006407923.1| hypothetical protein EUTSA_v10020323mg [Eutr... 82 1e-13 ref|XP_006395061.1| hypothetical protein EUTSA_v10003846mg [Eutr... 82 1e-13 ref|XP_002314948.2| hypothetical protein POPTR_0010s15590g [Popu... 82 1e-13 ref|XP_006841447.1| hypothetical protein AMTR_s00003p00077760 [A... 82 1e-13 gb|AGV54464.1| ATP-citrate synthase beta chain protein 1-like pr... 82 1e-13 ref|XP_004967570.1| PREDICTED: ATP-citrate synthase beta chain p... 82 1e-13 ref|XP_007035804.1| ATP citrate lyase subunit B 2 isoform 1 [The... 82 1e-13 ref|XP_007051142.1| ATP citrate lyase subunit B 2 isoform 1 [The... 82 1e-13 ref|XP_004486545.1| PREDICTED: ATP-citrate synthase beta chain p... 82 1e-13 >ref|XP_001759152.1| predicted protein [Physcomitrella patens] gi|162689851|gb|EDQ76221.1| predicted protein [Physcomitrella patens] Length = 610 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK*T 268 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK T Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTKYT 610 >ref|XP_001760999.1| predicted protein [Physcomitrella patens] gi|162687685|gb|EDQ74066.1| predicted protein [Physcomitrella patens] Length = 610 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK*T 268 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK T Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTKYT 610 >gb|EYU45496.1| hypothetical protein MIMGU_mgv1a003086mg [Mimulus guttatus] Length = 609 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 573 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 609 >gb|EYU29663.1| hypothetical protein MIMGU_mgv1a003097mg [Mimulus guttatus] gi|604317912|gb|EYU29664.1| hypothetical protein MIMGU_mgv1a003097mg [Mimulus guttatus] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|EXC24961.1| ATP-citrate synthase beta chain protein 1 [Morus notabilis] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006488840.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Citrus sinensis] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006358207.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like isoform X1 [Solanum tuberosum] gi|565384577|ref|XP_006358208.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like isoform X2 [Solanum tuberosum] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006349840.1| PREDICTED: ATP-citrate synthase beta chain protein 2-like [Solanum tuberosum] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_007154379.1| hypothetical protein PHAVU_003G114300g, partial [Phaseolus vulgaris] gi|561027733|gb|ESW26373.1| hypothetical protein PHAVU_003G114300g, partial [Phaseolus vulgaris] Length = 553 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 517 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 553 >ref|XP_007147365.1| hypothetical protein PHAVU_006G118100g [Phaseolus vulgaris] gi|561020588|gb|ESW19359.1| hypothetical protein PHAVU_006G118100g [Phaseolus vulgaris] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006419381.1| hypothetical protein CICLE_v10004572mg [Citrus clementina] gi|557521254|gb|ESR32621.1| hypothetical protein CICLE_v10004572mg [Citrus clementina] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006407923.1| hypothetical protein EUTSA_v10020323mg [Eutrema salsugineum] gi|557109069|gb|ESQ49376.1| hypothetical protein EUTSA_v10020323mg [Eutrema salsugineum] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_006395061.1| hypothetical protein EUTSA_v10003846mg [Eutrema salsugineum] gi|557091700|gb|ESQ32347.1| hypothetical protein EUTSA_v10003846mg [Eutrema salsugineum] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_002314948.2| hypothetical protein POPTR_0010s15590g [Populus trichocarpa] gi|550329880|gb|EEF01119.2| hypothetical protein POPTR_0010s15590g [Populus trichocarpa] Length = 616 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 580 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 616 >ref|XP_006841447.1| hypothetical protein AMTR_s00003p00077760 [Amborella trichopoda] gi|548843468|gb|ERN03122.1| hypothetical protein AMTR_s00003p00077760 [Amborella trichopoda] Length = 627 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 591 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 627 >gb|AGV54464.1| ATP-citrate synthase beta chain protein 1-like protein [Phaseolus vulgaris] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004967570.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Setaria italica] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_007035804.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] gi|508714833|gb|EOY06730.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_007051142.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] gi|590719755|ref|XP_007051143.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] gi|508703403|gb|EOX95299.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] gi|508703404|gb|EOX95300.1| ATP citrate lyase subunit B 2 isoform 1 [Theobroma cacao] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004486545.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cicer arietinum] Length = 608 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 384 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 274 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 572 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608