BLASTX nr result
ID: Mentha22_contig00004093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00004093 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270662.1| PREDICTED: coatomer subunit epsilon-1 isofor... 58 2e-06 emb|CAN78678.1| hypothetical protein VITISV_013598 [Vitis vinifera] 58 2e-06 gb|EYU19071.1| hypothetical protein MIMGU_mgv1a011115mg [Mimulus... 57 3e-06 ref|XP_006356904.1| PREDICTED: coatomer subunit epsilon-1-like [... 56 5e-06 >ref|XP_002270662.1| PREDICTED: coatomer subunit epsilon-1 isoform 1 [Vitis vinifera] gi|297740898|emb|CBI31080.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 1 YLSQLKLSHPDHTLVIRASTAEEVFDRAVQTV 96 YLSQLKLSHPDH LV RAS AEE FDRAVQT+ Sbjct: 257 YLSQLKLSHPDHVLVTRASAAEEAFDRAVQTI 288 >emb|CAN78678.1| hypothetical protein VITISV_013598 [Vitis vinifera] Length = 125 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 1 YLSQLKLSHPDHTLVIRASTAEEVFDRAVQTV 96 YLSQLKLSHPDH LV RAS AEE FDRAVQT+ Sbjct: 93 YLSQLKLSHPDHVLVTRASAAEEAFDRAVQTI 124 >gb|EYU19071.1| hypothetical protein MIMGU_mgv1a011115mg [Mimulus guttatus] Length = 292 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +1 Query: 1 YLSQLKLSHPDHTLVIRASTAEEVFDRAVQTV 96 YLSQLKLSHPDH LV RAST EE FDRAVQTV Sbjct: 260 YLSQLKLSHPDHVLVKRASTGEESFDRAVQTV 291 >ref|XP_006356904.1| PREDICTED: coatomer subunit epsilon-1-like [Solanum tuberosum] Length = 291 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 YLSQLKLSHPDHTLVIRASTAEEVFDRAVQTV 96 YLSQLK+SHPDH LV RA++AEE+FDRAVQTV Sbjct: 259 YLSQLKISHPDHMLVGRAASAEEIFDRAVQTV 290