BLASTX nr result
ID: Mentha22_contig00003623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00003623 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26425.1| hypothetical protein MIMGU_mgv1a008742mg [Mimulus... 85 9e-15 >gb|EYU26425.1| hypothetical protein MIMGU_mgv1a008742mg [Mimulus guttatus] Length = 364 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = -3 Query: 255 MAAMAQLRFSPLAGNYSLPSGGRDITNSSPIFADNTFANSIAFPSLKCSGNLMGNLDLQS 76 MA M+QLR+SPL+G+Y +G R+ TN +PIFAD T N+I+ PSLKCS + D QS Sbjct: 1 MATMSQLRYSPLSGHYRSTTGSREFTNLTPIFADITLPNAISLPSLKCSRKISSTPDFQS 60 Query: 75 KFHLPCA 55 KFHLPCA Sbjct: 61 KFHLPCA 67