BLASTX nr result
ID: Mentha22_contig00001753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00001753 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841224.1| hypothetical protein AMTR_s00135p00052570 [A... 103 2e-20 ref|XP_003526535.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 103 2e-20 ref|XP_004167244.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 102 4e-20 ref|XP_004148412.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 102 4e-20 ref|XP_003615260.1| Glucose-6-phosphate isomerase [Medicago trun... 102 7e-20 ref|XP_007141251.1| hypothetical protein PHAVU_008G180200g [Phas... 101 9e-20 ref|XP_003519196.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 101 9e-20 gb|EYU36464.1| hypothetical protein MIMGU_mgv1a002902mg [Mimulus... 100 2e-19 ref|XP_007222012.1| hypothetical protein PRUPE_ppa002932mg [Prun... 100 2e-19 ref|XP_004490428.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 100 4e-19 ref|XP_004490427.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 100 4e-19 emb|CBI19242.3| unnamed protein product [Vitis vinifera] 100 4e-19 ref|XP_002285697.1| PREDICTED: glucose-6-phosphate isomerase iso... 100 4e-19 ref|XP_002285696.1| PREDICTED: glucose-6-phosphate isomerase iso... 100 4e-19 ref|XP_003522754.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 99 5e-19 ref|XP_006283347.1| hypothetical protein CARUB_v10004391mg [Caps... 99 6e-19 gb|AAF24124.1|AF120494_1 phosphoglucose isomerase precursor [Ara... 99 6e-19 gb|AFC88848.1| glucose-6-phosphate isomerase, partial [Tetragoni... 99 6e-19 ref|XP_002867655.1| hypothetical protein ARALYDRAFT_492381 [Arab... 99 6e-19 ref|NP_194193.2| phosphoglucose isomerase 1 [Arabidopsis thalian... 99 6e-19 >ref|XP_006841224.1| hypothetical protein AMTR_s00135p00052570 [Amborella trichopoda] gi|548843140|gb|ERN02899.1| hypothetical protein AMTR_s00135p00052570 [Amborella trichopoda] Length = 624 Score = 103 bits (257), Expect = 2e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKI+AHMAANDRALIAEGSCGSPRSIKVFLGECNVDE+YA Sbjct: 574 RCHAPEQIEMIYKIVAHMAANDRALIAEGSCGSPRSIKVFLGECNVDELYA 624 >ref|XP_003526535.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like [Glycine max] Length = 615 Score = 103 bits (257), Expect = 2e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECN+DE+YA Sbjct: 565 RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNIDELYA 615 >ref|XP_004167244.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like [Cucumis sativus] Length = 624 Score = 102 bits (255), Expect = 4e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVD++YA Sbjct: 574 RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDDLYA 624 >ref|XP_004148412.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like [Cucumis sativus] Length = 624 Score = 102 bits (255), Expect = 4e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVD++YA Sbjct: 574 RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDDLYA 624 >ref|XP_003615260.1| Glucose-6-phosphate isomerase [Medicago truncatula] gi|355516595|gb|AES98218.1| Glucose-6-phosphate isomerase [Medicago truncatula] Length = 622 Score = 102 bits (253), Expect = 7e-20 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IE+IYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVDEMYA Sbjct: 572 RCHAPEDIEVIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDEMYA 622 >ref|XP_007141251.1| hypothetical protein PHAVU_008G180200g [Phaseolus vulgaris] gi|561014384|gb|ESW13245.1| hypothetical protein PHAVU_008G180200g [Phaseolus vulgaris] Length = 609 Score = 101 bits (252), Expect = 9e-20 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEG+CGSPRSIKVFLGECN+DE+YA Sbjct: 559 RCHAPEDIEMIYKIIAHMAANDRALIAEGNCGSPRSIKVFLGECNLDELYA 609 >ref|XP_003519196.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like [Glycine max] Length = 613 Score = 101 bits (252), Expect = 9e-20 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEG+CGSPRSIKVFLGECN+DE+YA Sbjct: 563 RCHAPEDIEMIYKIIAHMAANDRALIAEGNCGSPRSIKVFLGECNLDELYA 613 >gb|EYU36464.1| hypothetical protein MIMGU_mgv1a002902mg [Mimulus guttatus] Length = 627 Score = 100 bits (249), Expect = 2e-19 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMY 300 RCH+PN+IEMIYKIIAHMAANDRALIAEGSCGSPRS+KV+LGECNV EMY Sbjct: 577 RCHSPNDIEMIYKIIAHMAANDRALIAEGSCGSPRSVKVYLGECNVGEMY 626 >ref|XP_007222012.1| hypothetical protein PRUPE_ppa002932mg [Prunus persica] gi|462418948|gb|EMJ23211.1| hypothetical protein PRUPE_ppa002932mg [Prunus persica] Length = 620 Score = 100 bits (249), Expect = 2e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCH+P +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVD +YA Sbjct: 570 RCHSPEQIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDALYA 620 >ref|XP_004490428.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 619 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IE+IYKIIAHMAANDRA++AEGSCGSPRSIKVFLGECNVD++YA Sbjct: 569 RCHAPEDIEVIYKIIAHMAANDRAILAEGSCGSPRSIKVFLGECNVDDLYA 619 >ref|XP_004490427.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 614 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IE+IYKIIAHMAANDRA++AEGSCGSPRSIKVFLGECNVD++YA Sbjct: 564 RCHAPEDIEVIYKIIAHMAANDRAILAEGSCGSPRSIKVFLGECNVDDLYA 614 >emb|CBI19242.3| unnamed protein product [Vitis vinifera] Length = 480 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGEC VD++YA Sbjct: 430 RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECYVDDLYA 480 >ref|XP_002285697.1| PREDICTED: glucose-6-phosphate isomerase isoform 2 [Vitis vinifera] Length = 615 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGEC VD++YA Sbjct: 565 RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECYVDDLYA 615 >ref|XP_002285696.1| PREDICTED: glucose-6-phosphate isomerase isoform 1 [Vitis vinifera] Length = 623 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGEC VD++YA Sbjct: 573 RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECYVDDLYA 623 >ref|XP_003522754.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like [Glycine max] Length = 615 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP +IEMIYKIIAHMAANDRALI EGSCGSPRSIKVFLGECN+D +YA Sbjct: 565 RCHAPEDIEMIYKIIAHMAANDRALIVEGSCGSPRSIKVFLGECNIDGLYA 615 >ref|XP_006283347.1| hypothetical protein CARUB_v10004391mg [Capsella rubella] gi|482552052|gb|EOA16245.1| hypothetical protein CARUB_v10004391mg [Capsella rubella] Length = 614 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP EIEMIYKIIAHM+ANDR LIAEG+CGSPRSIKV+LGECNVD++YA Sbjct: 564 RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA 614 >gb|AAF24124.1|AF120494_1 phosphoglucose isomerase precursor [Arabidopsis thaliana] Length = 612 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP EIEMIYKIIAHM+ANDR LIAEG+CGSPRSIKV+LGECNVD++YA Sbjct: 562 RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA 612 >gb|AFC88848.1| glucose-6-phosphate isomerase, partial [Tetragonia tetragonioides] Length = 496 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCH P +IEMIYKIIAHMAANDRALIAEGSCGSPRSIK FL ECNVDEMYA Sbjct: 446 RCHCPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKAFLQECNVDEMYA 496 >ref|XP_002867655.1| hypothetical protein ARALYDRAFT_492381 [Arabidopsis lyrata subsp. lyrata] gi|297313491|gb|EFH43914.1| hypothetical protein ARALYDRAFT_492381 [Arabidopsis lyrata subsp. lyrata] Length = 613 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP EIEMIYKIIAHM+ANDR LIAEG+CGSPRSIKV+LGECNVD++YA Sbjct: 563 RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA 613 >ref|NP_194193.2| phosphoglucose isomerase 1 [Arabidopsis thaliana] gi|75151856|sp|Q8H103.1|G6PIP_ARATH RecName: Full=Glucose-6-phosphate isomerase 1, chloroplastic; Short=GPI 1; AltName: Full=Phosphoglucose isomerase 1; Short=PGI 1; AltName: Full=Phosphohexose isomerase; Short=PHI; Flags: Precursor gi|24030384|gb|AAN41353.1| putative glucose-6-phosphate isomerase [Arabidopsis thaliana] gi|110742488|dbj|BAE99162.1| glucose-6-phosphate isomerase [Arabidopsis thaliana] gi|332659533|gb|AEE84933.1| phosphoglucose isomerase 1 [Arabidopsis thaliana] Length = 613 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 449 RCHAPNEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMYA 297 RCHAP EIEMIYKIIAHM+ANDR LIAEG+CGSPRSIKV+LGECNVD++YA Sbjct: 563 RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA 613