BLASTX nr result
ID: Magnolia22_contig00037342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037342 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018860066.1 PREDICTED: disease resistance protein At4g27190-l... 53 8e-06 XP_018860065.1 PREDICTED: probable disease resistance protein At... 53 8e-06 >XP_018860066.1 PREDICTED: disease resistance protein At4g27190-like isoform X2 [Juglans regia] Length = 738 Score = 52.8 bits (125), Expect = 8e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -1 Query: 302 LLLSDCSKLETMPSLAKLTNLIVLDLSNTCIKELPEGVEAL 180 L L++C LE +PSL +L+ L+VLDLS TCI+ELP G+E L Sbjct: 591 LRLNNCKYLEKLPSLERLSRLLVLDLSGTCIRELPRGLEQL 631 >XP_018860065.1 PREDICTED: probable disease resistance protein At4g27220 isoform X1 [Juglans regia] Length = 971 Score = 52.8 bits (125), Expect = 8e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -1 Query: 302 LLLSDCSKLETMPSLAKLTNLIVLDLSNTCIKELPEGVEAL 180 L L++C LE +PSL +L+ L+VLDLS TCI+ELP G+E L Sbjct: 591 LRLNNCKYLEKLPSLERLSRLLVLDLSGTCIRELPRGLEQL 631