BLASTX nr result
ID: Magnolia22_contig00037336
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037336 (637 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007674385.1 hypothetical protein BAUCODRAFT_32024, partial [B... 77 3e-15 KXL43860.1 hypothetical protein FE78DRAFT_81409 [Acidomyces rich... 77 3e-15 GAM90336.1 hypothetical protein ANO11243_083790 [fungal sp. No.1... 77 3e-15 XP_013343551.1 hypothetical protein AUEXF2481DRAFT_40431 [Aureob... 77 3e-15 XP_003847709.1 40S ribosomal protein S27 [Zymoseptoria tritici I... 77 3e-15 EME38718.1 zinc-binding ribosomal protein S27e-like protein [Dot... 76 1e-14 OMP88758.1 40S ribosomal protein S27, partial [Diplodia seriata] 75 1e-14 OCL13278.1 hypothetical protein AOQ84DRAFT_225958 [Glonium stell... 75 2e-14 XP_007587859.1 putative 40s ribosomal protein s27 protein [Neofu... 75 2e-14 EKG11584.1 Ribosomal protein S27e [Macrophomina phaseolina MS6] ... 75 2e-14 KLJ13688.1 40S ribosomal protein S27 [Emmonsia parva UAMH 139] 75 2e-14 OCK95726.1 hypothetical protein K441DRAFT_556006 [Cenococcum geo... 75 2e-14 XP_001394925.1 40S ribosomal protein S27 [Aspergillus niger CBS ... 75 2e-14 XP_754942.1 40S ribosomal protein S27 [Aspergillus fumigatus Af2... 75 2e-14 XP_003190521.1 40S ribosomal protein S27 [Aspergillus oryzae RIB... 75 2e-14 XP_001217341.1 40S ribosomal protein S27 [Aspergillus terreus NI... 75 2e-14 XP_020133466.1 40s ribosomal protein s27 [Diplodia corticola] OJ... 75 2e-14 KIN07629.1 hypothetical protein OIDMADRAFT_109290, partial [Oidi... 75 3e-14 OJI83320.1 hypothetical protein ASPTUDRAFT_191767 [Aspergillus t... 75 3e-14 EPQ64747.1 Protein component of the small (40S) ribosomal subuni... 75 3e-14 >XP_007674385.1 hypothetical protein BAUCODRAFT_32024, partial [Baudoinia panamericana UAMH 10762] EMC98021.1 hypothetical protein BAUCODRAFT_32024, partial [Baudoinia panamericana UAMH 10762] Length = 81 Score = 77.4 bits (189), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 47 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 81 >KXL43860.1 hypothetical protein FE78DRAFT_81409 [Acidomyces richmondensis] KYG44589.1 hypothetical protein M433DRAFT_144761 [Acidomyces richmondensis BFW] Length = 82 Score = 77.4 bits (189), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >GAM90336.1 hypothetical protein ANO11243_083790 [fungal sp. No.11243] Length = 82 Score = 77.4 bits (189), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >XP_013343551.1 hypothetical protein AUEXF2481DRAFT_40431 [Aureobasidium subglaciale EXF-2481] XP_013425671.1 hypothetical protein M436DRAFT_74432 [Aureobasidium namibiae CBS 147.97] KEQ63167.1 hypothetical protein M437DRAFT_75057 [Aureobasidium melanogenum CBS 110374] KEQ71342.1 hypothetical protein M436DRAFT_74432 [Aureobasidium namibiae CBS 147.97] KEQ87224.1 hypothetical protein M438DRAFT_372758 [Aureobasidium pullulans EXF-150] KEQ95164.1 hypothetical protein AUEXF2481DRAFT_40431 [Aureobasidium subglaciale EXF-2481] Length = 82 Score = 77.4 bits (189), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >XP_003847709.1 40S ribosomal protein S27 [Zymoseptoria tritici IPO323] XP_007923807.1 hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] XP_016756120.1 40S ribosomal protein S27 [Sphaerulina musiva SO2202] EGP82685.1 hypothetical protein MYCGRDRAFT_64763 [Zymoseptoria tritici IPO323] EME86590.1 hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] EMF07999.1 40S ribosomal protein S27 [Sphaerulina musiva SO2202] KJX95277.1 40s ribosomal protein s27 [Zymoseptoria brevis] KXT00548.1 hypothetical protein AC578_5227 [Mycosphaerella eumusae] KXT10554.1 hypothetical protein AC579_8330 [Pseudocercospora musae] Length = 82 Score = 77.4 bits (189), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >EME38718.1 zinc-binding ribosomal protein S27e-like protein [Dothistroma septosporum NZE10] Length = 82 Score = 75.9 bits (185), Expect = 1e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVV CAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVTCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >OMP88758.1 40S ribosomal protein S27, partial [Diplodia seriata] Length = 81 Score = 75.5 bits (184), Expect = 1e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 47 SHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 81 >OCL13278.1 hypothetical protein AOQ84DRAFT_225958 [Glonium stellatum] Length = 82 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >XP_007587859.1 putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] EOD44675.1 putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] Length = 82 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >EKG11584.1 Ribosomal protein S27e [Macrophomina phaseolina MS6] KKY28981.1 putative 40s ribosomal protein s27 [Diplodia seriata] Length = 82 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >KLJ13688.1 40S ribosomal protein S27 [Emmonsia parva UAMH 139] Length = 60 Score = 74.7 bits (182), Expect = 2e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 26 SHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 60 >OCK95726.1 hypothetical protein K441DRAFT_556006 [Cenococcum geophilum 1.58] Length = 89 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 55 SHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 89 >XP_001394925.1 40S ribosomal protein S27 [Aspergillus niger CBS 513.88] CAK40840.1 unnamed protein product [Aspergillus niger] GAA85773.1 40S ribosomal protein S27 [Aspergillus kawachii IFO 4308] GAQ44670.1 40S ribosomal protein S27 [Aspergillus niger] Length = 82 Score = 75.1 bits (183), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >XP_754942.1 40S ribosomal protein S27 [Aspergillus fumigatus Af293] XP_001270683.1 40S ribosomal protein S27 [Aspergillus clavatus NRRL 1] EAL92904.1 40S ribosomal protein S27, putative [Aspergillus fumigatus Af293] EAW09257.1 40S ribosomal protein S27, putative [Aspergillus clavatus NRRL 1] CEL07822.1 Putative 40S ribosomal protein S27 [Aspergillus calidoustus] OOF98609.1 hypothetical protein ASPCADRAFT_204367 [Aspergillus carbonarius ITEM 5010] Length = 82 Score = 75.1 bits (183), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >XP_003190521.1 40S ribosomal protein S27 [Aspergillus oryzae RIB40] KKK21691.1 40S ribosomal protein [Aspergillus ochraceoroseus] KOC15046.1 40S ribosomal protein [Aspergillus flavus AF70] OGM46410.1 hypothetical protein ABOM_004768 [Aspergillus bombycis] Length = 82 Score = 75.1 bits (183), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >XP_001217341.1 40S ribosomal protein S27 [Aspergillus terreus NIH2624] EAU30887.1 40S ribosomal protein S27 [Aspergillus terreus NIH2624] Length = 82 Score = 75.1 bits (183), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 48 SHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >XP_020133466.1 40s ribosomal protein s27 [Diplodia corticola] OJD37327.1 40s ribosomal protein s27 [Diplodia corticola] Length = 96 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 62 SHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 96 >KIN07629.1 hypothetical protein OIDMADRAFT_109290, partial [Oidiodendron maius Zn] Length = 78 Score = 74.7 bits (182), Expect = 3e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 44 SHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 78 >OJI83320.1 hypothetical protein ASPTUDRAFT_191767 [Aspergillus tubingensis CBS 134.48] OJZ91327.1 hypothetical protein ASPFODRAFT_203762 [Aspergillus luchuensis CBS 106.47] Length = 91 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 57 SHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 91 >EPQ64747.1 Protein component of the small (40S) ribosomal subunit, partial [Blumeria graminis f. sp. tritici 96224] Length = 81 Score = 74.7 bits (182), Expect = 3e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 2 SHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 106 SHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 SHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 81