BLASTX nr result
ID: Magnolia22_contig00037225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037225 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN80796.1 hypothetical protein VITISV_034275 [Vitis vinifera] 110 1e-25 XP_010660114.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-25 XP_007134420.1 hypothetical protein PHAVU_010G046000g [Phaseolus... 109 2e-25 BAT04554.1 Os08g0249600, partial [Oryza sativa Japonica Group] 100 4e-25 XP_011624686.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 5e-25 XP_015885877.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 1e-24 XP_011622555.1 PREDICTED: putative pentatricopeptide repeat-cont... 107 1e-24 XP_017983349.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 2e-24 XP_011660280.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 2e-24 XP_011626680.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 2e-24 KDP29911.1 hypothetical protein JCGZ_18480 [Jatropha curcas] 102 2e-24 XP_018822219.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 3e-24 XP_008366695.1 PREDICTED: pentatricopeptide repeat-containing pr... 104 3e-24 GAU35898.1 hypothetical protein TSUD_383900 [Trifolium subterran... 101 4e-24 XP_010103704.1 hypothetical protein L484_001891 [Morus notabilis... 105 4e-24 EOY30985.1 Pentatricopeptide repeat-containing protein, putative... 100 4e-24 CBI35164.3 unnamed protein product, partial [Vitis vinifera] 105 4e-24 XP_007225539.1 hypothetical protein PRUPE_ppa026705mg [Prunus pe... 104 7e-24 OMO90854.1 hypothetical protein COLO4_18835 [Corchorus olitorius] 105 7e-24 XP_010923707.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 7e-24 >CAN80796.1 hypothetical protein VITISV_034275 [Vitis vinifera] Length = 771 Score = 110 bits (274), Expect = 1e-25 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LI+ P+TPIRIVKNLRVC DCH+ TKL+SKIYGR IIVRDRNRFHHF+EGYCSC DYW Sbjct: 713 LISTAPSTPIRIVKNLRVCNDCHAATKLLSKIYGRVIIVRDRNRFHHFREGYCSCGDYW 771 >XP_010660114.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Vitis vinifera] Length = 801 Score = 110 bits (274), Expect = 1e-25 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LI+ P+TPIRIVKNLRVC DCH+ TKL+SKIYGR IIVRDRNRFHHF+EGYCSC DYW Sbjct: 743 LISTAPSTPIRIVKNLRVCNDCHAATKLLSKIYGRVIIVRDRNRFHHFREGYCSCGDYW 801 >XP_007134420.1 hypothetical protein PHAVU_010G046000g [Phaseolus vulgaris] ESW06414.1 hypothetical protein PHAVU_010G046000g [Phaseolus vulgaris] Length = 1216 Score = 109 bits (273), Expect = 2e-25 Identities = 47/59 (79%), Positives = 52/59 (88%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LI+ P PIRIVKNLR+C DCH+ TKL+SKIYGR+IIVRDRNRFHHFQEGYCSC DYW Sbjct: 1158 LISTAPGVPIRIVKNLRICDDCHNATKLLSKIYGREIIVRDRNRFHHFQEGYCSCCDYW 1216 >BAT04554.1 Os08g0249600, partial [Oryza sativa Japonica Group] Length = 104 Score = 100 bits (249), Expect = 4e-25 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LIN + PIRIVKNLRVC DCH VTKLISK+YGR+IIVRDR RFH F++G CSCKDYW Sbjct: 46 LINTSDDMPIRIVKNLRVCHDCHHVTKLISKVYGREIIVRDRTRFHLFKDGSCSCKDYW 104 >XP_011624686.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Amborella trichopoda] Length = 795 Score = 108 bits (270), Expect = 5e-25 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LI+ P TPIRIVKNLRVC DCHS TKLISKIYGR+IIVRDRNR+HHF+EG CSC+DYW Sbjct: 737 LISTAPCTPIRIVKNLRVCDDCHSATKLISKIYGREIIVRDRNRYHHFKEGSCSCRDYW 795 >XP_015885877.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Ziziphus jujuba] Length = 606 Score = 107 bits (267), Expect = 1e-24 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIRIVKNLRVC DCHS TK ISKIY R+I+VRDRNRFHHF++G+CSCKD+W Sbjct: 548 LLNSPPGTPIRIVKNLRVCSDCHSATKFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 606 >XP_011622555.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Amborella trichopoda] Length = 534 Score = 107 bits (266), Expect = 1e-24 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -3 Query: 370 INLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 I+LGP PIRIVKNLRVC DCH VTKL+SK++GR+I+VRDRNRFHHF++G CSC DYW Sbjct: 477 ISLGPEVPIRIVKNLRVCTDCHDVTKLMSKVFGREIVVRDRNRFHHFRDGTCSCMDYW 534 >XP_017983349.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Theobroma cacao] Length = 609 Score = 107 bits (266), Expect = 2e-24 Identities = 47/59 (79%), Positives = 51/59 (86%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LIN P TPIRIVKNLRVC DCHS TKLISKIY R+II RDRNRFHHF++G CSCKD+W Sbjct: 551 LINTPPGTPIRIVKNLRVCNDCHSATKLISKIYNREIIARDRNRFHHFKDGLCSCKDFW 609 >XP_011660280.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Cucumis sativus] KGN66788.1 hypothetical protein Csa_1G690260 [Cucumis sativus] Length = 765 Score = 107 bits (266), Expect = 2e-24 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LI+ P TPIRIVKNLR+C DCH+ TKL+SKIYGR IIVRDRNRFHHF EGYCSC YW Sbjct: 707 LISTAPGTPIRIVKNLRICDDCHAATKLLSKIYGRTIIVRDRNRFHHFSEGYCSCMGYW 765 >XP_011626680.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 534 Score = 106 bits (265), Expect = 2e-24 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = -3 Query: 370 INLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 IN+ P TPIRI+KNLRVC+DCH TKLISKIY R+IIVRDRNRFHHF EG CSC DYW Sbjct: 477 INMDPKTPIRIIKNLRVCIDCHIATKLISKIYNREIIVRDRNRFHHFIEGACSCADYW 534 >KDP29911.1 hypothetical protein JCGZ_18480 [Jatropha curcas] Length = 247 Score = 102 bits (254), Expect = 2e-24 Identities = 43/59 (72%), Positives = 52/59 (88%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LIN+G +PIRI+KNLRVC DCH+VTKL+SKIY R+IIVRD +RFHHF+ G CSCKD+W Sbjct: 189 LINMGSGSPIRIIKNLRVCNDCHTVTKLLSKIYSREIIVRDNSRFHHFKHGTCSCKDFW 247 >XP_018822219.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Juglans regia] XP_018822221.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Juglans regia] Length = 618 Score = 106 bits (264), Expect = 3e-24 Identities = 44/59 (74%), Positives = 52/59 (88%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIRIVKNLRVC DCH+ TK IS+IY R+I+VRDRNRFHHF+EG+CSCKD+W Sbjct: 560 LLNTPPGTPIRIVKNLRVCNDCHAATKFISRIYNREIVVRDRNRFHHFREGFCSCKDFW 618 >XP_008366695.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like, partial [Malus domestica] Length = 366 Score = 104 bits (259), Expect = 3e-24 Identities = 43/59 (72%), Positives = 51/59 (86%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIRIVKNLRVC DCHS TK ISK+Y R+I+VRDRNRFHHF++G CSC+D+W Sbjct: 308 LLNTPPGTPIRIVKNLRVCDDCHSATKFISKVYNREIVVRDRNRFHHFKDGMCSCRDFW 366 >GAU35898.1 hypothetical protein TSUD_383900 [Trifolium subterraneum] Length = 219 Score = 101 bits (251), Expect = 4e-24 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIR+VKNLRVC DCH KLISK+Y R+I++RDR+RFHHF+ G CSCKDYW Sbjct: 127 LLNTAPGTPIRVVKNLRVCADCHMAIKLISKVYDREIVIRDRSRFHHFRGGSCSCKDYW 185 >XP_010103704.1 hypothetical protein L484_001891 [Morus notabilis] EXB96783.1 hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 105 bits (263), Expect = 4e-24 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIRIVKNLRVC DCHS TK ISKIY R+I+VRDRNRFHHF +G CSCKD+W Sbjct: 541 LLNTPPGTPIRIVKNLRVCSDCHSATKFISKIYNREIVVRDRNRFHHFMDGLCSCKDFW 599 >EOY30985.1 Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 194 Score = 100 bits (249), Expect = 4e-24 Identities = 43/59 (72%), Positives = 51/59 (86%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 LI+ P T IRIVKNLRVC +CHS TKLISKI+ ++II RDRNRFHHF++G+CSCKDYW Sbjct: 136 LISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNKEIIARDRNRFHHFKDGFCSCKDYW 194 >CBI35164.3 unnamed protein product, partial [Vitis vinifera] Length = 663 Score = 105 bits (263), Expect = 4e-24 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDY 200 LI+ P+TPIRIVKNLRVC DCH+ TKL+SKIYGR IIVRDRNRFHHF+EGYCSC DY Sbjct: 587 LISTAPSTPIRIVKNLRVCNDCHAATKLLSKIYGRVIIVRDRNRFHHFREGYCSCGDY 644 >XP_007225539.1 hypothetical protein PRUPE_ppa026705mg [Prunus persica] Length = 484 Score = 104 bits (260), Expect = 7e-24 Identities = 44/59 (74%), Positives = 51/59 (86%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIRIVKNLRVC DCHS TK ISKIY R+I+VRDRNRFHHF++G CSC+D+W Sbjct: 426 LLNTPPGTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSCRDFW 484 >OMO90854.1 hypothetical protein COLO4_18835 [Corchorus olitorius] Length = 609 Score = 105 bits (261), Expect = 7e-24 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P TPIRIVKNLRVC DCHS TKLISKIY R+II RDRNRFHHF++G CSC D+W Sbjct: 551 LLNTSPGTPIRIVKNLRVCNDCHSATKLISKIYNREIIARDRNRFHHFKDGLCSCNDFW 609 >XP_010923707.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Elaeis guineensis] Length = 626 Score = 105 bits (261), Expect = 7e-24 Identities = 44/59 (74%), Positives = 51/59 (86%) Frame = -3 Query: 373 LINLGPNTPIRIVKNLRVCVDCHSVTKLISKIYGRKIIVRDRNRFHHFQEGYCSCKDYW 197 L+N P PIRIVKNLRVC DCH VTKLISK+Y R+I+VRDR+RFHHF++G CSCKDYW Sbjct: 568 LLNSAPGVPIRIVKNLRVCADCHLVTKLISKVYNREIVVRDRSRFHHFRDGSCSCKDYW 626