BLASTX nr result
ID: Magnolia22_contig00037160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037160 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010250871.1 PREDICTED: uncharacterized protein LOC104592979 [... 58 8e-07 XP_011004389.1 PREDICTED: uncharacterized protein LOC105110887 [... 55 6e-06 XP_002317032.1 hypothetical protein POPTR_0011s15040g [Populus t... 55 6e-06 XP_002300535.2 hypothetical protein POPTR_0001s45880g [Populus t... 55 9e-06 >XP_010250871.1 PREDICTED: uncharacterized protein LOC104592979 [Nelumbo nucifera] Length = 555 Score = 57.8 bits (138), Expect = 8e-07 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +1 Query: 73 YLVPRRLCCRVNQTSDEQLEVTVRQCERGISGSVVDSV 186 +L+PRRLCC+VNQT+D+ L +TVRQCERG SG + +SV Sbjct: 518 HLMPRRLCCKVNQTTDQFLRLTVRQCERGYSGFLDESV 555 >XP_011004389.1 PREDICTED: uncharacterized protein LOC105110887 [Populus euphratica] Length = 537 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +1 Query: 73 YLVPRRLCCRVNQTSDEQLEVTVRQCERGISGSVVDSV 186 +L PRRLCC++NQTSDE L ++V QCE+G GS DSV Sbjct: 500 HLSPRRLCCKLNQTSDELLTISVGQCEKGSCGSFADSV 537 >XP_002317032.1 hypothetical protein POPTR_0011s15040g [Populus trichocarpa] EEE97644.1 hypothetical protein POPTR_0011s15040g [Populus trichocarpa] Length = 537 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +1 Query: 73 YLVPRRLCCRVNQTSDEQLEVTVRQCERGISGSVVDSV 186 +L PRRLCC++NQTSDE L ++V QCE+G GS DSV Sbjct: 500 HLSPRRLCCKLNQTSDELLTISVGQCEKGSCGSFADSV 537 >XP_002300535.2 hypothetical protein POPTR_0001s45880g [Populus trichocarpa] EEE85340.2 hypothetical protein POPTR_0001s45880g [Populus trichocarpa] Length = 539 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +1 Query: 73 YLVPRRLCCRVNQTSDEQLEVTVRQCERGISGSVVDSV 186 +L PRRLCC++NQTSDE L ++VRQC +G GS DSV Sbjct: 502 HLSPRRLCCKLNQTSDELLTISVRQCGKGSFGSFADSV 539