BLASTX nr result
ID: Magnolia22_contig00037061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037061 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19234.1 hypothetical protein TSUD_199160, partial [Trifolium ... 79 5e-17 AGC78976.1 hypothetical protein (mitochondrion) [Vicia faba] 79 6e-17 XP_003612011.1 hypothetical protein MTR_5g020310 [Medicago trunc... 74 2e-14 YP_588275.1 hypothetical protein ZeamMp009 (mitochondrion) [Zea ... 62 5e-10 >GAU19234.1 hypothetical protein TSUD_199160, partial [Trifolium subterraneum] Length = 88 Score = 79.3 bits (194), Expect = 5e-17 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 2 MFPERGRLLSGQQSSTSSRLLYDGLPCFLGSARSSTLRPSK 124 MFPE GRLLSGQQSSTSSRLLYDGLPC LGSARSSTLRPSK Sbjct: 1 MFPEGGRLLSGQQSSTSSRLLYDGLPCILGSARSSTLRPSK 41 >AGC78976.1 hypothetical protein (mitochondrion) [Vicia faba] Length = 96 Score = 79.3 bits (194), Expect = 6e-17 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 2 MFPERGRLLSGQQSSTSSRLLYDGLPCFLGSARSSTLRPSK 124 MFPE GRLLSGQQSSTSSRLLYDGLPC LGSARSSTLRPSK Sbjct: 56 MFPEGGRLLSGQQSSTSSRLLYDGLPCILGSARSSTLRPSK 96 >XP_003612011.1 hypothetical protein MTR_5g020310 [Medicago truncatula] AES94969.1 hypothetical protein MTR_5g020310 [Medicago truncatula] Length = 127 Score = 73.9 bits (180), Expect = 2e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +2 Query: 2 MFPERGRLLSGQQSSTSSRLLYDGLPCFLGSARSSTLRPS 121 MFPE GRLLSGQQSSTSSRLLYDGLPC LGSA SSTLRPS Sbjct: 27 MFPEVGRLLSGQQSSTSSRLLYDGLPCILGSACSSTLRPS 66 >YP_588275.1 hypothetical protein ZeamMp009 (mitochondrion) [Zea mays subsp. mays] AAR91139.1 hypothetical protein (mitochondrion) [Zea mays] Length = 115 Score = 62.0 bits (149), Expect = 5e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +2 Query: 2 MFPERGRLLSGQQSSTSSRLLYDGLPCFLGSARSSTLRPSKS 127 MFPER LLSGQQS T SRLLYD L FLGSARSSTLRP +S Sbjct: 66 MFPERDCLLSGQQSYTYSRLLYDDLTSFLGSARSSTLRPIQS 107