BLASTX nr result
ID: Magnolia22_contig00036863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036863 (434 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009315883.1 ORF1 polyprotein [Grapevine asteroid mosaic-assoc... 67 3e-10 ALX72769.1 polyprotein [Nectarine virus M] 65 1e-09 YP_009222597.1 polyprotein [Nectarine virus M] ALX72768.1 polypr... 65 1e-09 AQM73513.1 polyprotein, partial [Citrus sudden death-associated ... 62 6e-09 ALX72770.1 polyprotein [Nectarine virus M] 64 6e-09 AQM73522.1 polyprotein, partial [Citrus sudden death-associated ... 62 8e-09 AQM73507.1 polyprotein, partial [Citrus sudden death-associated ... 62 8e-09 AQM73503.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73505.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73521.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73519.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73510.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73506.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73527.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73508.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73500.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73499.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73520.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73524.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 AQM73501.1 polyprotein, partial [Citrus sudden death-associated ... 61 1e-08 >YP_009315883.1 ORF1 polyprotein [Grapevine asteroid mosaic-associated virus] AOX24075.1 ORF1 polyprotein [Grapevine asteroid mosaic-associated virus] Length = 2158 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = -2 Query: 427 SWTGLTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKP 266 SW + + AA +PLA+ A+R LGPDSPQ +HDQY MFHP W L+L+RKP Sbjct: 560 SW--IPYALGAAAIPLALLAVRWFLGPDSPQAMHDQYHAMFHPPDWHLTLDRKP 611 >ALX72769.1 polyprotein [Nectarine virus M] Length = 2055 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYH 260 L + I+AA LPL +R LGPDSPQ LHD+Y +FHP+PW L L+R P H Sbjct: 505 LWLSIAAASLPLIALGVRFFLGPDSPQSLHDRYHALFHPEPWELVLKRGPVH 556 >YP_009222597.1 polyprotein [Nectarine virus M] ALX72768.1 polyprotein [Nectarine virus M] Length = 2055 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYH 260 L + I+AA LPL +R LGPDSPQ LHD+Y +FHP+PW L L+R P H Sbjct: 505 LWLSIAAASLPLIALGVRFFLGPDSPQSLHDRYHALFHPEPWELVLKRGPVH 556 >AQM73513.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 62.0 bits (149), Expect = 6e-09 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + I+ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGIALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLTRKAICC 98 >ALX72770.1 polyprotein [Nectarine virus M] Length = 2137 Score = 63.5 bits (153), Expect = 6e-09 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = -2 Query: 430 ISWTGLTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYH 260 IS L + +AA +PL IR LGPDSPQ LHD+Y +FHP+PW L L+R P H Sbjct: 582 ISQKYLWLSAAAASVPLIALGIRFFLGPDSPQSLHDRYHALFHPEPWELVLKRGPVH 638 >AQM73522.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L I ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKIGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLTRKAICC 98 >AQM73507.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + + A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW LSL RK C Sbjct: 46 LKVGFALATVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLSLARKAICC 98 >AQM73503.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73505.1 polyprotein, partial [Citrus sudden death-associated virus] AQM73511.1 polyprotein, partial [Citrus sudden death-associated virus] AQM73512.1 polyprotein, partial [Citrus sudden death-associated virus] AQM73515.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73521.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73519.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73510.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73506.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73527.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73508.1 polyprotein, partial [Citrus sudden death-associated virus] AQM73525.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73500.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLTRKAICC 98 >AQM73499.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98 >AQM73520.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLTRKAICC 98 >AQM73524.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLTRKAICC 98 >AQM73501.1 polyprotein, partial [Citrus sudden death-associated virus] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -2 Query: 415 LTICISAAILPLAMFAIRRALGPDSPQMLHDQYEVMFHPKPWVLSLERKPYHC 257 L + ++ A +P+ +F R+ +GPDSPQ +HD Y MFHP+PW L+L RK C Sbjct: 46 LKVGLALAAVPVCLFLWRKFIGPDSPQDMHDSYHAMFHPQPWGLTLARKAICC 98