BLASTX nr result
ID: Magnolia22_contig00036825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036825 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010255448.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 3e-16 XP_010662774.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 6e-16 KDP22290.1 hypothetical protein JCGZ_26121 [Jatropha curcas] 75 2e-13 XP_012090268.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-13 GAV81268.1 PPR domain-containing protein/PPR_2 domain-containing... 75 3e-13 XP_010934731.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 3e-13 XP_006377070.1 hypothetical protein POPTR_0012s13270g [Populus t... 74 4e-13 XP_011030096.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 6e-13 XP_017972944.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 XP_007038671.2 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 EOY23172.1 Tetratricopeptide repeat superfamily protein, putativ... 73 1e-12 XP_011470378.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 XP_017189493.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 3e-12 XP_008234467.2 PREDICTED: pentatricopeptide repeat-containing pr... 70 1e-11 XP_007219543.1 hypothetical protein PRUPE_ppa022784mg [Prunus pe... 70 1e-11 ONI25286.1 hypothetical protein PRUPE_2G293600 [Prunus persica] 70 1e-11 XP_009340067.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-11 XP_008806854.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 XP_011076487.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 XP_015581233.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 >XP_010255448.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nelumbo nucifera] Length = 564 Score = 83.2 bits (204), Expect = 3e-16 Identities = 39/54 (72%), Positives = 48/54 (88%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 D+ LAE+VMERI EL++NESGVYVLLSNIYA GQW +A+ AREKME++KIWK+ Sbjct: 499 DLRLAEEVMERIDELKTNESGVYVLLSNIYASAGQWPKAVNAREKMEDKKIWKR 552 >XP_010662774.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 561 Score = 82.4 bits (202), Expect = 6e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKKA 202 D++LAE+V+ER L +NESGVYVLLSNIYA GQW EAL AREKMEE+K+WKKA Sbjct: 494 DLKLAEEVVERAGGLEANESGVYVLLSNIYASAGQWPEALSAREKMEEKKVWKKA 548 >KDP22290.1 hypothetical protein JCGZ_26121 [Jatropha curcas] Length = 492 Score = 75.1 bits (183), Expect = 2e-13 Identities = 37/55 (67%), Positives = 46/55 (83%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKKA 202 +++LAEKV++R +EL +NESGVYVLLSNIYA GQW EAL AR MEE+KI K+A Sbjct: 432 ELKLAEKVIQRAIELEANESGVYVLLSNIYASVGQWQEALCARGNMEEKKIMKEA 486 >XP_012090268.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Jatropha curcas] Length = 554 Score = 75.1 bits (183), Expect = 2e-13 Identities = 37/55 (67%), Positives = 46/55 (83%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKKA 202 +++LAEKV++R +EL +NESGVYVLLSNIYA GQW EAL AR MEE+KI K+A Sbjct: 494 ELKLAEKVIQRAIELEANESGVYVLLSNIYASVGQWQEALCARGNMEEKKIMKEA 548 >GAV81268.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 550 Score = 74.7 bits (182), Expect = 3e-13 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKKA 202 D+ LAEKV+ER EL ++E GVY+LLSNI+A GQW EA AREKME R +WKKA Sbjct: 490 DLNLAEKVVERASELEASEPGVYILLSNIHASMGQWAEAQSAREKMEGRNMWKKA 544 >XP_010934731.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Elaeis guineensis] Length = 558 Score = 74.7 bits (182), Expect = 3e-13 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWK 208 D+ LAEK MERI EL +NE GVY L+SN+YA +W EAL+AR KME+R IWK Sbjct: 492 DLRLAEKAMERIAELETNEGGVYALVSNMYAASSEWNEALKARHKMEQRGIWK 544 >XP_006377070.1 hypothetical protein POPTR_0012s13270g [Populus trichocarpa] ERP54867.1 hypothetical protein POPTR_0012s13270g [Populus trichocarpa] Length = 480 Score = 74.3 bits (181), Expect = 4e-13 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 D++LAEKV+E+ E+ +NESGVYVLLSNI+A GQW+EA AR+KM+E+KI KK Sbjct: 421 DLKLAEKVVEKATEMETNESGVYVLLSNIHASAGQWIEAADARKKMDEKKISKK 474 >XP_011030096.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Populus euphratica] Length = 553 Score = 73.9 bits (180), Expect = 6e-13 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKKA 202 D++LAEKV+E+ E+ +NESGVYVLLSNI+A GQW+EA AR+ M+E+KI KKA Sbjct: 494 DLKLAEKVLEKATEMETNESGVYVLLSNIHASAGQWIEAADARKTMDEKKISKKA 548 >XP_017972944.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 isoform X2 [Theobroma cacao] Length = 468 Score = 73.2 bits (178), Expect = 1e-12 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 D++LAEKV+ER EL S ESGV+VL SNI+A GQW +AL AR+KMEERKI KK Sbjct: 408 DLKLAEKVVERATELESKESGVHVLSSNIHASVGQWPQALNARQKMEERKILKK 461 >XP_007038671.2 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 isoform X1 [Theobroma cacao] Length = 546 Score = 73.2 bits (178), Expect = 1e-12 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 D++LAEKV+ER EL S ESGV+VL SNI+A GQW +AL AR+KMEERKI KK Sbjct: 486 DLKLAEKVVERATELESKESGVHVLSSNIHASVGQWPQALNARQKMEERKILKK 539 >EOY23172.1 Tetratricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 546 Score = 73.2 bits (178), Expect = 1e-12 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 D++LAEKV+ER EL S ESGV+VL SNI+A GQW +AL AR+KMEERKI KK Sbjct: 486 DLKLAEKVVERATELESKESGVHVLSSNIHASVGQWPQALNARQKMEERKILKK 539 >XP_011470378.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Fragaria vesca subsp. vesca] Length = 545 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -2 Query: 363 IELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWK 208 ++LAE+V+E+ EL +NESGVYVLLSN++A GQW EA AREKMEE++IWK Sbjct: 484 LKLAEEVIEKATELEANESGVYVLLSNMHASVGQWPEAQSAREKMEEKRIWK 535 >XP_017189493.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Malus domestica] Length = 188 Score = 69.7 bits (169), Expect = 3e-12 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -2 Query: 363 IELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWK 208 ++LAE+V+E+ EL ++ESGVYVLL+N+ A GQW EA AREKMEE+KIWK Sbjct: 94 LKLAEEVIEKATELETDESGVYVLLANMRASAGQWPEAQSAREKMEEKKIWK 145 >XP_008234467.2 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Prunus mume] Length = 524 Score = 70.5 bits (171), Expect = 1e-11 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -2 Query: 360 ELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 +LAE+V+ER L +NESGVYVLLSN A GQW EA AREKM+E+KIWKK Sbjct: 444 KLAEEVIERATGLETNESGVYVLLSNTRASAGQWPEAQSAREKMDEKKIWKK 495 >XP_007219543.1 hypothetical protein PRUPE_ppa022784mg [Prunus persica] Length = 498 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -2 Query: 360 ELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 +LAE+VMER L +NESGVYVLLSN +A G+W EA ARE M+E+KIWKK Sbjct: 422 KLAEEVMERATGLETNESGVYVLLSNTHASAGKWPEAQSARENMDEKKIWKK 473 >ONI25286.1 hypothetical protein PRUPE_2G293600 [Prunus persica] Length = 576 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -2 Query: 360 ELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 +LAE+VMER L +NESGVYVLLSN +A G+W EA ARE M+E+KIWKK Sbjct: 496 KLAEEVMERATGLETNESGVYVLLSNTHASAGKWPEAQSARENMDEKKIWKK 547 >XP_009340067.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Pyrus x bretschneideri] Length = 590 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -2 Query: 363 IELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWK 208 ++LAE+V+E+ EL ++ESGVYVLL+N+ A GQW EA AREKMEE+KIWK Sbjct: 495 LKLAEEVIEKATELETDESGVYVLLANMRASAGQWPEAQSAREKMEEKKIWK 546 >XP_008806854.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Phoenix dactylifera] Length = 404 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWK 208 D+ LAEK MERI EL +E GVY L+SN+YA +W EAL+AR+KME+R I K Sbjct: 338 DLRLAEKAMERIAELEVDEGGVYALVSNMYAASSEWNEALKARQKMEQRGIQK 390 >XP_011076487.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Sesamum indicum] Length = 554 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKK 205 +++LAE ++ + +ELRS ESGV+VLLSNI+A GQW EALR R+ MEE +I KK Sbjct: 494 NLKLAENIISKAIELRSEESGVHVLLSNIHASMGQWSEALRTRKLMEENRILKK 547 >XP_015581233.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Ricinus communis] Length = 555 Score = 66.6 bits (161), Expect = 2e-10 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -2 Query: 366 DIELAEKVMERILELRSNESGVYVLLSNIYALEGQWLEALRAREKMEERKIWKKA 202 D LAEK ++R+ +L + ESGVYVLLSNIYA G+W EAL AR KME++KI K+A Sbjct: 495 DSNLAEKAIKRVGDLETAESGVYVLLSNIYASMGRWTEALGARGKMEKKKIRKEA 549