BLASTX nr result
ID: Magnolia22_contig00036462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036462 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY38032.1 hypothetical protein MANES_11G147300 [Manihot esculenta] 72 7e-12 XP_009611941.1 PREDICTED: protein CNGC15b-like [Nicotiana toment... 71 2e-11 XP_011657002.1 PREDICTED: putative cyclic nucleotide-gated ion c... 70 3e-11 XP_010313416.1 PREDICTED: protein CNGC15b [Solanum lycopersicum] 69 9e-11 XP_019255416.1 PREDICTED: protein CNGC15b [Nicotiana attenuata] ... 69 9e-11 XP_016483627.1 PREDICTED: putative cyclic nucleotide-gated ion c... 68 2e-10 XP_009788225.1 PREDICTED: putative cyclic nucleotide-gated ion c... 68 2e-10 XP_008463956.1 PREDICTED: putative cyclic nucleotide-gated ion c... 68 2e-10 XP_015056668.1 PREDICTED: putative cyclic nucleotide-gated ion c... 67 4e-10 KZM97113.1 hypothetical protein DCAR_015525 [Daucus carota subsp... 67 4e-10 XP_019052790.1 PREDICTED: protein CNGC15b isoform X1 [Nelumbo nu... 67 6e-10 XP_006340177.1 PREDICTED: putative cyclic nucleotide-gated ion c... 66 8e-10 XP_011089272.1 PREDICTED: putative cyclic nucleotide-gated ion c... 66 8e-10 XP_012064795.1 PREDICTED: putative cyclic nucleotide-gated ion c... 66 1e-09 XP_011657004.1 PREDICTED: putative cyclic nucleotide-gated ion c... 65 1e-09 XP_010253719.1 PREDICTED: protein CNGC15b isoform X2 [Nelumbo nu... 65 1e-09 XP_016548568.1 PREDICTED: putative cyclic nucleotide-gated ion c... 65 2e-09 XP_006357568.1 PREDICTED: putative cyclic nucleotide-gated ion c... 64 4e-09 CBI16330.3 unnamed protein product, partial [Vitis vinifera] 64 5e-09 XP_010651183.1 PREDICTED: protein CNGC15b [Vitis vinifera] 64 5e-09 >OAY38032.1 hypothetical protein MANES_11G147300 [Manihot esculenta] Length = 704 Score = 72.0 bits (175), Expect = 7e-12 Identities = 38/66 (57%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQK-KGSRSL 21 MAYGNSRSVRF+DDLE+A T D++IK KYNID ++ +SS +K + K RSL Sbjct: 1 MAYGNSRSVRFKDDLELAKLATVNGDDVIKLKYNIDGTQLSESSSRKSEKEMPGKNGRSL 60 Query: 20 KAKVLS 3 KAKVLS Sbjct: 61 KAKVLS 66 >XP_009611941.1 PREDICTED: protein CNGC15b-like [Nicotiana tomentosiformis] XP_016453101.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana tabacum] XP_018629387.1 PREDICTED: protein CNGC15b-like [Nicotiana tomentosiformis] Length = 710 Score = 70.9 bits (172), Expect = 2e-11 Identities = 36/65 (55%), Positives = 45/65 (69%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDLE F T DN+IK KY ID ++P+ + +K + + +SLK Sbjct: 1 MAYGNSRSVRFQDDLESTKFATINGDNLIKVKYKIDGSQLPELANRKNEKEDIRTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_011657002.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Cucumis sativus] XP_011657003.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Cucumis sativus] Length = 723 Score = 70.1 bits (170), Expect = 3e-11 Identities = 39/73 (53%), Positives = 48/73 (65%) Frame = -1 Query: 221 KLEFQIIAMAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQ 42 K F+ I MAYG+SRSVRFQDDLE + T + K YNID +IP+SS K+ + Sbjct: 16 KFSFENIFMAYGSSRSVRFQDDLESSALPTINGGGVTKIIYNIDGTQIPESSGKRTAASR 75 Query: 41 KKGSRSLKAKVLS 3 K G RSL+AKVLS Sbjct: 76 KSG-RSLRAKVLS 87 >XP_010313416.1 PREDICTED: protein CNGC15b [Solanum lycopersicum] Length = 707 Score = 68.9 bits (167), Expect = 9e-11 Identities = 34/65 (52%), Positives = 44/65 (67%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDLE + + DN+IK KYNID +P+ + + + + +SLK Sbjct: 1 MAYGNSRSVRFQDDLESSKYAAMNGDNVIKVKYNIDGSRLPEPASRMSEMEPHRTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_019255416.1 PREDICTED: protein CNGC15b [Nicotiana attenuata] XP_019255417.1 PREDICTED: protein CNGC15b [Nicotiana attenuata] OIS96583.1 putative cyclic nucleotide-gated ion channel 15 [Nicotiana attenuata] Length = 710 Score = 68.9 bits (167), Expect = 9e-11 Identities = 35/65 (53%), Positives = 44/65 (67%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDLE + T DN+IK KY ID +P+ + +K + + +SLK Sbjct: 1 MAYGNSRSVRFQDDLESTKYATINGDNLIKVKYKIDGSRLPELANRKNEKEDIRTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_016483627.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15, partial [Nicotiana tabacum] Length = 613 Score = 67.8 bits (164), Expect = 2e-10 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDL+ + T DN+IK KY ID +P+ + +K + +SLK Sbjct: 1 MAYGNSRSVRFQDDLDTTKYATINGDNLIKVKYKIDGSRLPELASRKNEKEDITTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_009788225.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana sylvestris] Length = 710 Score = 67.8 bits (164), Expect = 2e-10 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDL+ + T DN+IK KY ID +P+ + +K + +SLK Sbjct: 1 MAYGNSRSVRFQDDLDTTKYATINGDNLIKVKYKIDGSRLPELASRKNEKEDITTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_008463956.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Cucumis melo] Length = 723 Score = 67.8 bits (164), Expect = 2e-10 Identities = 38/73 (52%), Positives = 47/73 (64%) Frame = -1 Query: 221 KLEFQIIAMAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQ 42 K F+ I MAYG+SRSVRFQDDLE + T + K YNID +IP+ S K+ + Sbjct: 16 KFSFEKIFMAYGSSRSVRFQDDLESSALPTINGGGVTKIIYNIDGTQIPELSGKRTAASR 75 Query: 41 KKGSRSLKAKVLS 3 K G RSL+AKVLS Sbjct: 76 KSG-RSLRAKVLS 87 >XP_015056668.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum pennellii] XP_015056669.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum pennellii] Length = 707 Score = 67.0 bits (162), Expect = 4e-10 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDLE + + DN+IK KY+ID +P+ + + + + +SLK Sbjct: 1 MAYGNSRSVRFQDDLESSKYAAMNGDNVIKVKYSIDGSRLPEPASRMSEMEPDRTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >KZM97113.1 hypothetical protein DCAR_015525 [Daucus carota subsp. sativus] Length = 2027 Score = 67.0 bits (162), Expect = 4e-10 Identities = 34/71 (47%), Positives = 46/71 (64%) Frame = -1 Query: 215 EFQIIAMAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKK 36 + ++ AMAYGNSRSVRFQDD E A DN+IK K+ ID + +S+ ++ + + Sbjct: 1313 QIELAAMAYGNSRSVRFQDDPEFAKLPVVNGDNVIKVKFKIDGTQFAESTSQRGERETGR 1372 Query: 35 GSRSLKAKVLS 3 RSLKAKVLS Sbjct: 1373 RGRSLKAKVLS 1383 >XP_019052790.1 PREDICTED: protein CNGC15b isoform X1 [Nelumbo nucifera] Length = 748 Score = 66.6 bits (161), Expect = 6e-10 Identities = 43/95 (45%), Positives = 55/95 (57%), Gaps = 1/95 (1%) Frame = -1 Query: 284 LIYLKILLSFVVHHRNF*PRQKLEFQIIAMAYGNSRSVRFQDDLEVAHFTTCKTDNIIKW 105 L+++K LL F R F M YGNSRSVRFQDD EVA T K ++IK Sbjct: 8 LMFIKFLLYFCSGSRRMNDSSG-GFLQSTMTYGNSRSVRFQDDPEVAKSTPSKGGHVIKL 66 Query: 104 KYNIDAVEIPKSSPKKVDGP-QKKGSRSLKAKVLS 3 Y ID +IP++S +K + +K +SLKAKVLS Sbjct: 67 MYKIDGTQIPETSFRKAEKEVAQKSGKSLKAKVLS 101 >XP_006340177.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] XP_006340178.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] XP_006340179.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] Length = 710 Score = 66.2 bits (160), Expect = 8e-10 Identities = 33/65 (50%), Positives = 42/65 (64%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDLE + DN+IK KY ID +P+ + + + + +SLK Sbjct: 1 MAYGNSRSVRFQDDLESTKYAAMNGDNVIKVKYKIDGSRLPEPASRMSEMEPDRTGKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_011089272.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Sesamum indicum] Length = 713 Score = 66.2 bits (160), Expect = 8e-10 Identities = 34/65 (52%), Positives = 42/65 (64%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAY NSRSVRF DD+E + +N+IK KY ID + +SS KK + GS+SLK Sbjct: 1 MAYTNSRSVRFHDDVEFSKLPIANGENVIKVKYKIDGTRVAESSSKKGEKSGNSGSKSLK 60 Query: 17 AKVLS 3 AKVLS Sbjct: 61 AKVLS 65 >XP_012064795.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Jatropha curcas] Length = 696 Score = 65.9 bits (159), Expect = 1e-09 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVD-GPQKKGSRSL 21 M YGNSRSVRF+DDLE+A T D + K+ YNID ++ +SS KK + KK +SL Sbjct: 1 MGYGNSRSVRFRDDLELAKHPTVNGDGLSKFTYNIDVTQVSESSSKKSEKEATKKSVKSL 60 Query: 20 KAKVLS 3 K+KVLS Sbjct: 61 KSKVLS 66 >XP_011657004.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X2 [Cucumis sativus] XP_011657005.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X2 [Cucumis sativus] KGN46846.1 hypothetical protein Csa_6G146420 [Cucumis sativus] Length = 700 Score = 65.5 bits (158), Expect = 1e-09 Identities = 36/65 (55%), Positives = 44/65 (67%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYG+SRSVRFQDDLE + T + K YNID +IP+SS K+ +K G RSL+ Sbjct: 1 MAYGSSRSVRFQDDLESSALPTINGGGVTKIIYNIDGTQIPESSGKRTAASRKSG-RSLR 59 Query: 17 AKVLS 3 AKVLS Sbjct: 60 AKVLS 64 >XP_010253719.1 PREDICTED: protein CNGC15b isoform X2 [Nelumbo nucifera] Length = 725 Score = 65.5 bits (158), Expect = 1e-09 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGP-QKKGSRSL 21 M YGNSRSVRFQDD EVA T K ++IK Y ID +IP++S +K + +K +SL Sbjct: 13 MTYGNSRSVRFQDDPEVAKSTPSKGGHVIKLMYKIDGTQIPETSFRKAEKEVAQKSGKSL 72 Query: 20 KAKVLS 3 KAKVLS Sbjct: 73 KAKVLS 78 >XP_016548568.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] XP_016548569.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] XP_016548571.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] XP_016548572.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] Length = 706 Score = 65.1 bits (157), Expect = 2e-09 Identities = 36/67 (53%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVD--GPQKKGSRS 24 MAYGNSRSVRFQDDLE + T DN+IK KY ID +P+ ++ P + G +S Sbjct: 1 MAYGNSRSVRFQDDLESTKYATMNGDNVIKVKYKIDGSRLPEPPGSRMSEKEPDRTG-KS 59 Query: 23 LKAKVLS 3 LKAKVLS Sbjct: 60 LKAKVLS 66 >XP_006357568.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] Length = 710 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGPQKKGSRSLK 18 MAYGNSRSVRFQDDLE + DN+I+ K+ +D V + + +K D G +SLK Sbjct: 1 MAYGNSRSVRFQDDLEATKYAPAHEDNVIEVKHKLDGVRQSEPASRKSDKKYDGGRKSLK 60 Query: 17 AKVLS 3 +KVLS Sbjct: 61 SKVLS 65 >CBI16330.3 unnamed protein product, partial [Vitis vinifera] Length = 697 Score = 63.9 bits (154), Expect = 5e-09 Identities = 37/66 (56%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGP-QKKGSRSL 21 MAY NSRSV+FQDDLE+A F D IK KY ID +I ++S KK K RSL Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYKKAGKEVSGKSGRSL 60 Query: 20 KAKVLS 3 KAKVLS Sbjct: 61 KAKVLS 66 >XP_010651183.1 PREDICTED: protein CNGC15b [Vitis vinifera] Length = 713 Score = 63.9 bits (154), Expect = 5e-09 Identities = 37/66 (56%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -1 Query: 197 MAYGNSRSVRFQDDLEVAHFTTCKTDNIIKWKYNIDAVEIPKSSPKKVDGP-QKKGSRSL 21 MAY NSRSV+FQDDLE+A F D IK KY ID +I ++S KK K RSL Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYKKAGKEVSGKSGRSL 60 Query: 20 KAKVLS 3 KAKVLS Sbjct: 61 KAKVLS 66