BLASTX nr result
ID: Magnolia22_contig00036406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036406 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018064692.1 hypothetical protein LY89DRAFT_689616 [Phialoceph... 66 5e-10 KIN08218.1 hypothetical protein OIDMADRAFT_175076 [Oidiodendron ... 65 1e-09 CZR62200.1 related to C6 transcription factor [Phialocephala sub... 65 1e-09 XP_007802789.1 hypothetical protein EPUS_00569 [Endocarpon pusil... 65 1e-09 KFY39550.1 hypothetical protein V495_05891 [Pseudogymnoascus sp.... 62 9e-09 KFX90857.1 hypothetical protein V490_06239 [Pseudogymnoascus sp.... 62 9e-09 KFX98536.1 hypothetical protein O988_04297 [Pseudogymnoascus sp.... 62 9e-09 KKY28759.1 putative zn 2cys6 transcription factor [Diplodia seri... 61 2e-08 XP_020128112.1 c6 transcription factor [Diplodia corticola] OJD3... 61 2e-08 XP_007580347.1 putative c6 transcription factor protein [Neofusi... 61 3e-08 KEQ84230.1 hypothetical protein M438DRAFT_374384 [Aureobasidium ... 61 3e-08 XP_007784622.1 hypothetical protein W97_08565 [Coniosporium apol... 61 3e-08 KIV81231.1 hypothetical protein PV11_08658 [Exophiala sideris] 60 6e-08 XP_013427870.1 hypothetical protein M436DRAFT_44550 [Aureobasidi... 60 6e-08 KFY94708.1 hypothetical protein V500_03102 [Pseudogymnoascus sp.... 60 6e-08 KEQ64697.1 hypothetical protein M437DRAFT_82699 [Aureobasidium m... 60 8e-08 XP_018075495.1 hypothetical protein LY89DRAFT_770371 [Phialoceph... 60 8e-08 XP_013340372.1 hypothetical protein AUEXF2481DRAFT_32670 [Aureob... 59 1e-07 OAK99081.1 hypothetical protein IQ06DRAFT_276876 [Stagonospora s... 59 2e-07 XP_018387680.1 hypothetical protein CC77DRAFT_986414 [Alternaria... 59 2e-07 >XP_018064692.1 hypothetical protein LY89DRAFT_689616 [Phialocephala scopiformis] KUJ10337.1 hypothetical protein LY89DRAFT_689616 [Phialocephala scopiformis] Length = 653 Score = 65.9 bits (159), Expect = 5e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KLRRI+RACD+CHKRSIRC+ P D D +RCQNC DFD Sbjct: 27 RKLRRISRACDFCHKRSIRCK-PSDEDPTRCQNCDDFD 63 >KIN08218.1 hypothetical protein OIDMADRAFT_175076 [Oidiodendron maius Zn] Length = 653 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDF 389 +KLRRITRACDYCHKRSIRCR P D + CQNCIDF Sbjct: 25 RKLRRITRACDYCHKRSIRCR-PSIEDRNSCQNCIDF 60 >CZR62200.1 related to C6 transcription factor [Phialocephala subalpina] Length = 663 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDF 389 +KLRRI+RACD+CHKRSIRC+ P DE+RCQNC+DF Sbjct: 27 RKLRRISRACDFCHKRSIRCK-PSTEDEARCQNCLDF 62 >XP_007802789.1 hypothetical protein EPUS_00569 [Endocarpon pusillum Z07020] ERF71580.1 hypothetical protein EPUS_00569 [Endocarpon pusillum Z07020] Length = 644 Score = 64.7 bits (156), Expect = 1e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFDQ 395 +K+RRI+RACDYCH RSIRCR + D RCQNC+DF+Q Sbjct: 9 RKVRRISRACDYCHHRSIRCRASEEGDGKRCQNCVDFNQ 47 >KFY39550.1 hypothetical protein V495_05891 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY56081.1 hypothetical protein V497_06530 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] Length = 697 Score = 62.4 bits (150), Expect = 9e-09 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDT-DESRCQNCIDFD 392 +KLRR+TRACD+CH+RS RC+ ++ D+SRCQNC+DFD Sbjct: 38 RKLRRVTRACDFCHRRSTRCKQSQESQDDSRCQNCLDFD 76 >KFX90857.1 hypothetical protein V490_06239 [Pseudogymnoascus sp. VKM F-3557] Length = 697 Score = 62.4 bits (150), Expect = 9e-09 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDT-DESRCQNCIDFD 392 +KLRR+TRACD+CH+RS RC+ ++ D+SRCQNC+DFD Sbjct: 38 RKLRRVTRACDFCHRRSTRCKQSQESQDDSRCQNCLDFD 76 >KFX98536.1 hypothetical protein O988_04297 [Pseudogymnoascus sp. VKM F-3808] Length = 725 Score = 62.4 bits (150), Expect = 9e-09 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDT-DESRCQNCIDFD 392 +KLRR+TRACD+CH+RS RC+ ++ D+SRCQNC+DFD Sbjct: 66 RKLRRVTRACDFCHRRSTRCKQSQESQDDSRCQNCLDFD 104 >KKY28759.1 putative zn 2cys6 transcription factor [Diplodia seriata] Length = 500 Score = 61.2 bits (147), Expect = 2e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KL+R +RACD+CHKRSIRCR ++D RCQNC+DFD Sbjct: 7 RKLQRASRACDFCHKRSIRCR-GSESDAERCQNCVDFD 43 >XP_020128112.1 c6 transcription factor [Diplodia corticola] OJD31852.1 c6 transcription factor [Diplodia corticola] Length = 614 Score = 61.2 bits (147), Expect = 2e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 KKL+R +RACD+CHKRSIRC+ ++D RCQNC+DFD Sbjct: 7 KKLQRASRACDFCHKRSIRCK-GSESDAQRCQNCVDFD 43 >XP_007580347.1 putative c6 transcription factor protein [Neofusicoccum parvum UCRNP2] EOD52165.1 putative c6 transcription factor protein [Neofusicoccum parvum UCRNP2] Length = 480 Score = 60.8 bits (146), Expect = 3e-08 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KL+R +RACD+CHKRSIRC+ ++D RCQNC+DFD Sbjct: 7 RKLQRASRACDFCHKRSIRCK-ASESDSQRCQNCVDFD 43 >KEQ84230.1 hypothetical protein M438DRAFT_374384 [Aureobasidium pullulans EXF-150] Length = 617 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KL+RI++ACD CH+RSIRCR P + D+ RCQNC DFD Sbjct: 7 RKLQRISQACDLCHRRSIRCR-PSNEDQERCQNCYDFD 43 >XP_007784622.1 hypothetical protein W97_08565 [Coniosporium apollinis CBS 100218] EON69305.1 hypothetical protein W97_08565 [Coniosporium apollinis CBS 100218] Length = 639 Score = 60.8 bits (146), Expect = 3e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +K++R +RACD+CHKRSIRC+ P D RCQNC+DFD Sbjct: 7 RKVQRASRACDFCHKRSIRCK-PSQEDAERCQNCVDFD 43 >KIV81231.1 hypothetical protein PV11_08658 [Exophiala sideris] Length = 585 Score = 60.1 bits (144), Expect = 6e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 282 KLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFDQ 395 K RRITRACDYCHKRSIRC + SRCQ+CIDFDQ Sbjct: 9 KSRRITRACDYCHKRSIRCT---SGNGSRCQSCIDFDQ 43 >XP_013427870.1 hypothetical protein M436DRAFT_44550 [Aureobasidium namibiae CBS 147.97] KEQ73861.1 hypothetical protein M436DRAFT_44550 [Aureobasidium namibiae CBS 147.97] Length = 605 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KL+RI++ACD CH+RSIRCR P + D RCQNC DFD Sbjct: 7 RKLQRISQACDLCHRRSIRCR-PSNEDNDRCQNCYDFD 43 >KFY94708.1 hypothetical protein V500_03102 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] Length = 695 Score = 60.1 bits (144), Expect = 6e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KLRR+TRACD+CH+RS RC D++RCQNC+DFD Sbjct: 38 RKLRRVTRACDFCHRRSTRCE--QSQDDNRCQNCLDFD 73 >KEQ64697.1 hypothetical protein M437DRAFT_82699 [Aureobasidium melanogenum CBS 110374] Length = 619 Score = 59.7 bits (143), Expect = 8e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KL+RI++ACD CH+RSIRCR P + D RCQNC DFD Sbjct: 7 RKLQRISQACDLCHRRSIRCR-PSNEDADRCQNCYDFD 43 >XP_018075495.1 hypothetical protein LY89DRAFT_770371 [Phialocephala scopiformis] KUJ21140.1 hypothetical protein LY89DRAFT_770371 [Phialocephala scopiformis] Length = 622 Score = 59.7 bits (143), Expect = 8e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDF 389 KK RRI+RACD+C++RSIRCR P D RCQNC+DF Sbjct: 9 KKRRRISRACDFCNRRSIRCR-PSQEDSDRCQNCVDF 44 >XP_013340372.1 hypothetical protein AUEXF2481DRAFT_32670 [Aureobasidium subglaciale EXF-2481] KEQ91932.1 hypothetical protein AUEXF2481DRAFT_32670 [Aureobasidium subglaciale EXF-2481] Length = 625 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 +KL+RI++ACD CH+RSIRCR P + D RCQNC DFD Sbjct: 7 RKLQRISQACDLCHRRSIRCR-PSNEDGDRCQNCYDFD 43 >OAK99081.1 hypothetical protein IQ06DRAFT_276876 [Stagonospora sp. SRC1lsM3a] Length = 677 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 KKL R +RACD+CHKRSI+C+ P T +RCQNC DFD Sbjct: 13 KKLLRASRACDFCHKRSIKCQ-PSATQSTRCQNCSDFD 49 >XP_018387680.1 hypothetical protein CC77DRAFT_986414 [Alternaria alternata] OAG22259.1 hypothetical protein CC77DRAFT_986414 [Alternaria alternata] Length = 681 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +3 Query: 279 KKLRRITRACDYCHKRSIRCRFPGDTDESRCQNCIDFD 392 KKL R +RACD+CHKRSIRCR P T CQNC DFD Sbjct: 9 KKLLRASRACDFCHKRSIRCR-PSATGSQSCQNCYDFD 45