BLASTX nr result
ID: Magnolia22_contig00036297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036297 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011457510.1 PREDICTED: putative pentatricopeptide repeat-cont... 107 5e-25 XP_010249165.1 PREDICTED: putative pentatricopeptide repeat-cont... 107 9e-25 XP_010249164.1 PREDICTED: putative pentatricopeptide repeat-cont... 107 9e-25 XP_010249162.1 PREDICTED: putative pentatricopeptide repeat-cont... 107 9e-25 XP_016494163.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-23 XP_017218501.1 PREDICTED: putative pentatricopeptide repeat-cont... 103 1e-23 XP_015075050.1 PREDICTED: putative pentatricopeptide repeat-cont... 103 2e-23 XP_006363265.1 PREDICTED: putative pentatricopeptide repeat-cont... 103 2e-23 XP_016563082.1 PREDICTED: putative pentatricopeptide repeat-cont... 103 2e-23 XP_004239299.1 PREDICTED: putative pentatricopeptide repeat-cont... 102 3e-23 XP_009378828.1 PREDICTED: putative pentatricopeptide repeat-cont... 102 3e-23 XP_008390176.1 PREDICTED: putative pentatricopeptide repeat-cont... 102 3e-23 XP_008222365.2 PREDICTED: LOW QUALITY PROTEIN: putative pentatri... 102 4e-23 AEW07829.1 hypothetical protein 0_12440_01, partial [Pinus lambe... 95 4e-23 AEW07828.1 hypothetical protein 0_12440_01, partial [Pinus radia... 95 4e-23 XP_010278232.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 5e-23 GAU21145.1 hypothetical protein TSUD_10620 [Trifolium subterraneum] 94 5e-23 CAA06832.1 DYW10 protein, partial [Arabidopsis thaliana] 94 5e-23 KDP40347.1 hypothetical protein JCGZ_02345 [Jatropha curcas] 101 7e-23 XP_012069857.1 PREDICTED: putative pentatricopeptide repeat-cont... 101 7e-23 >XP_011457510.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Fragaria vesca subsp. vesca] XP_004310131.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Fragaria vesca subsp. vesca] Length = 825 Score = 107 bits (268), Expect = 5e-25 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 P GSLIRI KNLRIC+DCHAT+K +SKVV+REIIVRDMNRFHHF+DG CSCGDYW Sbjct: 771 PSGSLIRIIKNLRICVDCHATVKLISKVVQREIIVRDMNRFHHFQDGICSCGDYW 825 >XP_010249165.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X3 [Nelumbo nucifera] XP_010249166.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X3 [Nelumbo nucifera] Length = 757 Score = 107 bits (266), Expect = 9e-25 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRIC+DCHA IKFVSKVV+REIIVRDMNRFHHF +G CSCGDYW Sbjct: 703 PPGSPIRIIKNLRICIDCHAAIKFVSKVVQREIIVRDMNRFHHFNNGICSCGDYW 757 >XP_010249164.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X2 [Nelumbo nucifera] Length = 810 Score = 107 bits (266), Expect = 9e-25 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRIC+DCHA IKFVSKVV+REIIVRDMNRFHHF +G CSCGDYW Sbjct: 756 PPGSPIRIIKNLRICIDCHAAIKFVSKVVQREIIVRDMNRFHHFNNGICSCGDYW 810 >XP_010249162.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Nelumbo nucifera] XP_010249163.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Nelumbo nucifera] Length = 834 Score = 107 bits (266), Expect = 9e-25 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRIC+DCHA IKFVSKVV+REIIVRDMNRFHHF +G CSCGDYW Sbjct: 780 PPGSPIRIIKNLRICIDCHAAIKFVSKVVQREIIVRDMNRFHHFNNGICSCGDYW 834 >XP_016494163.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494164.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494165.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494166.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] Length = 246 Score = 99.8 bits (247), Expect = 1e-23 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPG+ IR+ KNLRICLDCH KF+ K+V REII+RD+NRFHHF+DG CSCGDYW Sbjct: 192 PPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCSCGDYW 246 >XP_017218501.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Daucus carota subsp. sativus] XP_017218502.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Daucus carota subsp. sativus] XP_017218503.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Daucus carota subsp. sativus] XP_017218504.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Daucus carota subsp. sativus] Length = 824 Score = 103 bits (257), Expect = 1e-23 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 P GS IRI KNLRIC DCHA +KF+SKVV+REII+RD+NRFHHFEDG CSCGDYW Sbjct: 770 PSGSPIRIMKNLRICTDCHALVKFISKVVQREIIIRDINRFHHFEDGFCSCGDYW 824 >XP_015075050.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Solanum pennellii] Length = 830 Score = 103 bits (256), Expect = 2e-23 Identities = 42/55 (76%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRICLDCHA IKF+S +V+REI++RD+NRFHHF++G CSCGDYW Sbjct: 776 PPGSPIRIIKNLRICLDCHAAIKFISTLVQREIVIRDINRFHHFQNGACSCGDYW 830 >XP_006363265.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Solanum tuberosum] Length = 830 Score = 103 bits (256), Expect = 2e-23 Identities = 42/55 (76%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRICLDCHA IKF+S +V+REI++RD+NRFHHF++G CSCGDYW Sbjct: 776 PPGSPIRIIKNLRICLDCHAAIKFISTLVQREIVIRDINRFHHFQNGACSCGDYW 830 >XP_016563082.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Capsicum annuum] Length = 835 Score = 103 bits (256), Expect = 2e-23 Identities = 42/55 (76%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRICLDCHA IKF+S +V+REI++RD+NRFHHF++G CSCGDYW Sbjct: 781 PPGSPIRIIKNLRICLDCHAAIKFISTLVQREIVIRDINRFHHFQNGACSCGDYW 835 >XP_004239299.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Solanum lycopersicum] Length = 829 Score = 102 bits (255), Expect = 3e-23 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPGS IRI KNLRICLDCHA IKF+S +V+REI++RD+NRFHHF+ G CSCGDYW Sbjct: 775 PPGSPIRIIKNLRICLDCHAAIKFISTLVQREIVIRDINRFHHFQSGACSCGDYW 829 >XP_009378828.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Pyrus x bretschneideri] Length = 833 Score = 102 bits (255), Expect = 3e-23 Identities = 42/55 (76%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 P GS IRI KNLRIC+DCHAT+K +SK+V+R+IIVRD+NRFHHF+DG CSCGDYW Sbjct: 779 PSGSPIRIIKNLRICMDCHATVKLISKIVQRDIIVRDLNRFHHFQDGVCSCGDYW 833 >XP_008390176.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_008390177.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_008390178.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_017192118.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] Length = 833 Score = 102 bits (255), Expect = 3e-23 Identities = 42/55 (76%), Positives = 50/55 (90%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 P GS IRI KNLRIC+DCHAT+K +SK+V+R+IIVRD+NRFHHF+DG CSCGDYW Sbjct: 779 PSGSPIRIIKNLRICMDCHATVKLISKIVQRDIIVRDLNRFHHFQDGVCSCGDYW 833 >XP_008222365.2 PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Prunus mume] Length = 823 Score = 102 bits (254), Expect = 4e-23 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 6 PGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PGS IRI KNLRIC+DCHAT+K +SKVV+R+I+VRD+NRFHHF+DG CSCGDYW Sbjct: 770 PGSPIRIIKNLRICVDCHATVKLISKVVQRDIVVRDINRFHHFQDGICSCGDYW 823 >AEW07829.1 hypothetical protein 0_12440_01, partial [Pinus lambertiana] Length = 105 Score = 94.7 bits (234), Expect = 4e-23 Identities = 37/55 (67%), Positives = 47/55 (85%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPG+ IRI KNLR+C DCH+ K++SK+V REI++RD +RFHHF+DG CSCGDYW Sbjct: 51 PPGASIRIVKNLRVCDDCHSASKYISKIVSREIVMRDTSRFHHFKDGNCSCGDYW 105 >AEW07828.1 hypothetical protein 0_12440_01, partial [Pinus radiata] AFG45289.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45290.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45291.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45292.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45293.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45294.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45295.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45296.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45297.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45298.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45299.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45300.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45301.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45302.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45303.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45304.1 hypothetical protein 0_12440_01, partial [Pinus taeda] AFG45305.1 hypothetical protein 0_12440_01, partial [Pinus taeda] Length = 105 Score = 94.7 bits (234), Expect = 4e-23 Identities = 37/55 (67%), Positives = 47/55 (85%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPG+ IRI KNLR+C DCH+ K++SK+V REI++RD +RFHHF+DG CSCGDYW Sbjct: 51 PPGTSIRIVKNLRVCDDCHSASKYISKIVSREIVMRDTSRFHHFKDGNCSCGDYW 105 >XP_010278232.1 PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Nelumbo nucifera] Length = 713 Score = 102 bits (253), Expect = 5e-23 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPG+LI++FKNLR C+DCH IKF+SK+V REIIVRD NRFHHF+DG CSCGD+W Sbjct: 659 PPGTLIKVFKNLRTCVDCHTAIKFMSKIVGREIIVRDSNRFHHFKDGSCSCGDFW 713 >GAU21145.1 hypothetical protein TSUD_10620 [Trifolium subterraneum] Length = 105 Score = 94.4 bits (233), Expect = 5e-23 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = +3 Query: 6 PGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PGS IRI KN+R+C DCH+ IK+VS VV+REIIVRD NRFHHF DG CSC DYW Sbjct: 52 PGSTIRIMKNIRVCGDCHSAIKYVSLVVKREIIVRDTNRFHHFRDGSCSCRDYW 105 >CAA06832.1 DYW10 protein, partial [Arabidopsis thaliana] Length = 105 Score = 94.4 bits (233), Expect = 5e-23 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 P GS I++FKNLRIC DCH IKF+S++ +REIIVRD RFHHF+DG CSCGDYW Sbjct: 51 PEGSPIQVFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDGSCSCGDYW 105 >KDP40347.1 hypothetical protein JCGZ_02345 [Jatropha curcas] Length = 719 Score = 101 bits (252), Expect = 7e-23 Identities = 38/55 (69%), Positives = 49/55 (89%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPG++IR+ KN+R+C+DCH KF+SK+V REI+VRD NRFHHF+DG+CSCGDYW Sbjct: 665 PPGTIIRVTKNIRVCVDCHTATKFISKIVEREIVVRDNNRFHHFKDGKCSCGDYW 719 >XP_012069857.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Jatropha curcas] Length = 760 Score = 101 bits (252), Expect = 7e-23 Identities = 38/55 (69%), Positives = 49/55 (89%) Frame = +3 Query: 3 PPGSLIRIFKNLRICLDCHATIKFVSKVVRREIIVRDMNRFHHFEDGRCSCGDYW 167 PPG++IR+ KN+R+C+DCH KF+SK+V REI+VRD NRFHHF+DG+CSCGDYW Sbjct: 706 PPGTIIRVTKNIRVCVDCHTATKFISKIVEREIVVRDNNRFHHFKDGKCSCGDYW 760