BLASTX nr result
ID: Magnolia22_contig00036213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036213 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK80366.1 uncharacterized protein A4U43_C01F16880 [Asparagus of... 65 8e-10 XP_018813920.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 63 5e-09 XP_018846715.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 63 5e-09 XP_008351674.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 63 7e-09 XP_009336784.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 63 7e-09 XP_010095760.1 Ferric-chelate reductase 1 [Morus notabilis] EXB6... 63 8e-09 XP_007218114.1 hypothetical protein PRUPE_ppa006799mg [Prunus pe... 62 1e-08 ONI23416.1 hypothetical protein PRUPE_2G188200 [Prunus persica] 62 1e-08 XP_008233157.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 62 1e-08 XP_020106140.1 cytochrome b561 and DOMON domain-containing prote... 62 1e-08 XP_010915940.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 62 2e-08 OAY82332.1 Cytochrome b561 and DOMON domain-containing protein [... 62 2e-08 XP_010915939.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 62 2e-08 XP_017217320.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 61 3e-08 KQK09199.1 hypothetical protein BRADI_2g46630 [Brachypodium dist... 61 3e-08 XP_006644525.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 61 3e-08 XP_003569568.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 61 3e-08 XP_008783208.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 60 5e-08 XP_009394183.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 60 5e-08 XP_004308312.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 60 6e-08 >ONK80366.1 uncharacterized protein A4U43_C01F16880 [Asparagus officinalis] Length = 371 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = -3 Query: 169 QTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 QTDSC + L+C+P+WN+F+LRYS+ DNVLNIVLSAVYTSGW Sbjct: 21 QTDSCASDLSTFLPSPFNV-SGLSCKPIWNSFILRYSQDQDNVLNIVLSAVYTSGW 75 >XP_018813920.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750-like [Juglans regia] Length = 397 Score = 63.2 bits (152), Expect = 5e-09 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 L C+P+WNTF+LRYS++ D+VLNIVLSAVYT+GW Sbjct: 64 LVCKPIWNTFILRYSQSEDHVLNIVLSAVYTTGW 97 >XP_018846715.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750-like [Juglans regia] Length = 397 Score = 63.2 bits (152), Expect = 5e-09 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 L C+P+WNTF+LRYS++ D+VLNIVLSAVYT+GW Sbjct: 64 LVCKPIWNTFILRYSQSEDHVLNIVLSAVYTTGW 97 >XP_008351674.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750-like [Malus domestica] Length = 409 Score = 62.8 bits (151), Expect = 7e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 L CRP+WNTFVLRYS+ D+V+NI+LSAVYT+GW Sbjct: 74 LVCRPIWNTFVLRYSQTEDHVVNIILSAVYTTGW 107 >XP_009336784.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 [Pyrus x bretschneideri] Length = 410 Score = 62.8 bits (151), Expect = 7e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 L CRP+WNTFVLRYS+ D+V+NI+LSAVYT+GW Sbjct: 74 LVCRPIWNTFVLRYSQTEDHVVNIILSAVYTTGW 107 >XP_010095760.1 Ferric-chelate reductase 1 [Morus notabilis] EXB62180.1 Ferric-chelate reductase 1 [Morus notabilis] Length = 476 Score = 62.8 bits (151), Expect = 8e-09 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = -3 Query: 172 AQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 A T+ C T + C+PVWNTFVLRY++ DNV+NI+LSAVYT+GW Sbjct: 120 ADTEICNNDLSSFLPPPYSNITNVICKPVWNTFVLRYTQDEDNVVNIILSAVYTTGW 176 >XP_007218114.1 hypothetical protein PRUPE_ppa006799mg [Prunus persica] Length = 395 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 + CRP+WNTFVLRYS+ D+V+NI+LSAVYT+GW Sbjct: 63 IVCRPIWNTFVLRYSQTEDHVMNIILSAVYTTGW 96 >ONI23416.1 hypothetical protein PRUPE_2G188200 [Prunus persica] Length = 405 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 + CRP+WNTFVLRYS+ D+V+NI+LSAVYT+GW Sbjct: 73 IVCRPIWNTFVLRYSQTEDHVMNIILSAVYTTGW 106 >XP_008233157.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 [Prunus mume] Length = 405 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 + CRP+WNTFVLRYS+ D+V+NI+LSAVYT+GW Sbjct: 73 IVCRPIWNTFVLRYSQTEDHVMNIILSAVYTTGW 106 >XP_020106140.1 cytochrome b561 and DOMON domain-containing protein At3g61750-like [Ananas comosus] Length = 368 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 109 TALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 + L+CRPVWN FVLRYS++ DNVL+IVLSAVY +GW Sbjct: 41 SGLSCRPVWNNFVLRYSQSDDNVLSIVLSAVYATGW 76 >XP_010915940.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 isoform X2 [Elaeis guineensis] Length = 365 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/62 (48%), Positives = 39/62 (62%) Frame = -3 Query: 187 IRAVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTS 8 I AV +Q DSC + L C+P+WN+F+LRYS+ +NVL+IVLSA YTS Sbjct: 16 ITAVHSQVDSCGSDLSTFLPAPFNA-SDLKCKPIWNSFILRYSQNQENVLSIVLSAAYTS 74 Query: 7 GW 2 GW Sbjct: 75 GW 76 >OAY82332.1 Cytochrome b561 and DOMON domain-containing protein [Ananas comosus] Length = 368 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 L+CRPVWN FVLRYS++ DNVL+IVLSAVY +GW Sbjct: 43 LSCRPVWNNFVLRYSQSDDNVLSIVLSAVYATGW 76 >XP_010915939.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 isoform X1 [Elaeis guineensis] Length = 368 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/62 (48%), Positives = 39/62 (62%) Frame = -3 Query: 187 IRAVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTS 8 I AV +Q DSC + L C+P+WN+F+LRYS+ +NVL+IVLSA YTS Sbjct: 16 ITAVHSQVDSCGSDLSTFLPAPFNA-SDLKCKPIWNSFILRYSQNQENVLSIVLSAAYTS 74 Query: 7 GW 2 GW Sbjct: 75 GW 76 >XP_017217320.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750-like [Daucus carota subsp. sativus] Length = 409 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 + C+PVWNTFVLRYSKA D+ L IVLSA YTSGW Sbjct: 69 MICKPVWNTFVLRYSKAKDDTLTIVLSATYTSGW 102 >KQK09199.1 hypothetical protein BRADI_2g46630 [Brachypodium distachyon] Length = 332 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = -3 Query: 181 AVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 AV AQT SC + + CRPVWN FVLRY++ DNVL +VLSA+Y+SGW Sbjct: 27 AVTAQTSSCDDALPAELAGNY---SGMACRPVWNNFVLRYAQDGDNVLRVVLSAMYSSGW 83 >XP_006644525.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750-like [Oryza brachyantha] Length = 369 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/61 (47%), Positives = 37/61 (60%) Frame = -3 Query: 184 RAVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSG 5 RA AQT C + L CRPVWN+FVLRY++ DNVL +VLSA+Y++G Sbjct: 21 RAATAQTSGCDDALPPVLAGNY---SGLACRPVWNSFVLRYAQGKDNVLRVVLSAMYSTG 77 Query: 4 W 2 W Sbjct: 78 W 78 >XP_003569568.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 [Brachypodium distachyon] KQK09200.1 hypothetical protein BRADI_2g46630 [Brachypodium distachyon] Length = 375 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = -3 Query: 181 AVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 AV AQT SC + + CRPVWN FVLRY++ DNVL +VLSA+Y+SGW Sbjct: 27 AVTAQTSSCDDALPAELAGNY---SGMACRPVWNNFVLRYAQDGDNVLRVVLSAMYSSGW 83 >XP_008783208.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 [Phoenix dactylifera] Length = 368 Score = 60.5 bits (145), Expect = 5e-08 Identities = 29/62 (46%), Positives = 38/62 (61%) Frame = -3 Query: 187 IRAVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTS 8 I AV +Q DSC + L C+P+WN+F+LRYS+ +NV +IVLSA YTS Sbjct: 16 ITAVHSQVDSCGSDLSTFLPAPFNS-SGLNCKPIWNSFILRYSQNQENVSSIVLSAAYTS 74 Query: 7 GW 2 GW Sbjct: 75 GW 76 >XP_009394183.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 [Musa acuminata subsp. malaccensis] Length = 374 Score = 60.5 bits (145), Expect = 5e-08 Identities = 36/85 (42%), Positives = 42/85 (49%) Frame = -3 Query: 256 VSPQMFFRASAIAVXXXXXLDDEIRAVEAQTDSCXXXXXXXXXXXXXXSTALTCRPVWNT 77 VSP F A A+ V V AQ DSC T L+CRP+WN Sbjct: 7 VSPAFIFFALALVV------------VGAQPDSCSSRLPAALSNF----TGLSCRPIWNN 50 Query: 76 FVLRYSKAPDNVLNIVLSAVYTSGW 2 FVLRYS+ NVL++VLS YT GW Sbjct: 51 FVLRYSQDQQNVLSVVLSTTYTVGW 75 >XP_004308312.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g61750 [Fragaria vesca subsp. vesca] Length = 402 Score = 60.1 bits (144), Expect = 6e-08 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -3 Query: 103 LTCRPVWNTFVLRYSKAPDNVLNIVLSAVYTSGW 2 + C+P+WNTFVLRY++ D+V+NI+LSAVYT+GW Sbjct: 68 IVCKPIWNTFVLRYTQTDDHVMNIILSAVYTTGW 101