BLASTX nr result
ID: Magnolia22_contig00036063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00036063 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009316009.1 hypothetical protein (mitochondrion) [Cocos nucif... 65 3e-11 YP_007516852.1 hypothetical protein GlmaxMp02 (mitochondrion) [G... 64 7e-11 >YP_009316009.1 hypothetical protein (mitochondrion) [Cocos nucifera] AOX13003.1 hypothetical protein (mitochondrion) [Cocos nucifera] Length = 112 Score = 64.7 bits (156), Expect = 3e-11 Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = -2 Query: 191 VQIFYLLGNAFFSMNTPPLNDELC*SSPPTRTRENTWSSRYL--YLPSLNSCLLRLAKKG 18 +QI + LG+A SMNT PLNDEL SSPPTR ENT SS+ +LP NS LLRL +KG Sbjct: 10 LQIRHSLGDALLSMNTSPLNDELSQSSPPTRPGENTRSSQAALPHLPEWNSYLLRLVEKG 69 Query: 17 ES 12 +S Sbjct: 70 KS 71 >YP_007516852.1 hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] AFR34333.1 hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] Length = 104 Score = 63.5 bits (153), Expect = 7e-11 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -2 Query: 212 FLQHPCTVQIFYLLGNAFFSMNTPPLNDELC*SSPPTRTRENTWSSRYL 66 FL ++QI + LG+A FSMNTPPLNDELC SSPPTR ENT SS+ L Sbjct: 26 FLYERDSIQICHSLGDALFSMNTPPLNDELCQSSPPTRPGENTESSQAL 74